Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 46024..46549 Replicon plasmid p17-07187_2
Accession NZ_CP096978
Organism Escherichia coli strain 17-07187

Toxin (Protein)


Gene name ccdB Uniprot ID A0A0E0Y871
Locus tag M2894_RS25800 Protein ID WP_001159872.1
Coordinates 46244..46549 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A0E0Y6P9
Locus tag M2894_RS25795 Protein ID WP_000813638.1
Coordinates 46024..46242 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2894_RS25765 (M2894_25765) 41178..41333 + 156 WP_044713270.1 hypothetical protein -
M2894_RS25770 (M2894_25770) 41454..42194 + 741 WP_001066951.1 tyrosine-type recombinase/integrase -
M2894_RS25775 (M2894_25775) 42473..43450 - 978 WP_001387465.1 RepB family plasmid replication initiator protein -
M2894_RS25780 (M2894_25780) 44536..44691 + 156 WP_000332512.1 transposase domain-containing protein -
M2894_RS25785 (M2894_25785) 44774..45175 - 402 WP_001392130.1 type II toxin-antitoxin system VapC family toxin -
M2894_RS25790 (M2894_25790) 45199..45429 - 231 WP_001261288.1 type II toxin-antitoxin system VapB family antitoxin -
M2894_RS25795 (M2894_25795) 46024..46242 + 219 WP_000813638.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M2894_RS25800 (M2894_25800) 46244..46549 + 306 WP_001159872.1 type II toxin-antitoxin system toxin CcdB Toxin
M2894_RS25805 (M2894_25805) 46550..47356 + 807 WP_000016961.1 site-specific integrase -
M2894_RS25810 (M2894_25810) 47535..48179 + 645 WP_001144032.1 ParA family protein -
M2894_RS25815 (M2894_25815) 48266..48574 + 309 WP_000030204.1 molecular chaperone GroEL -
M2894_RS25820 (M2894_25820) 48988..49968 + 981 WP_000688504.1 plasmid segregation protein ParM -
M2894_RS25825 (M2894_25825) 49961..50377 + 417 WP_001278815.1 plasmid partitioning/stability family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - aggD / aggC / aggB / aggA / aap/aspU 1..75597 75597


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11722.51 Da        Isoelectric Point: 5.6919

>T244338 WP_001159872.1 NZ_CP096978:46244-46549 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHWENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8344.29 Da        Isoelectric Point: 4.5203

>AT244338 WP_000813638.1 NZ_CP096978:46024-46242 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQAENQEGMAEVAKFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y871

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y6P9

References