Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 39912..40471 Replicon plasmid p17-07187_2
Accession NZ_CP096978
Organism Escherichia coli strain 17-07187

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag M2894_RS25750 Protein ID WP_000421257.1
Coordinates 40196..40471 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag M2894_RS25745 Protein ID WP_001387467.1
Coordinates 39912..40196 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2894_RS25715 (M2894_25715) 35529..35729 - 201 WP_000643555.1 AggR-activated transcriptional regulator Aar -
M2894_RS25720 (M2894_25720) 35835..36150 - 316 Protein_34 hypothetical protein -
M2894_RS25725 (M2894_25725) 36322..37303 - 982 Protein_35 IS5-like element ISKpn26 family transposase -
M2894_RS25730 (M2894_25730) 37584..37838 + 255 WP_000083850.1 replication regulatory protein RepA -
M2894_RS25735 (M2894_25735) 38076..38150 + 75 WP_001365705.1 RepA leader peptide Tap -
M2894_RS25740 (M2894_25740) 38143..39019 + 877 Protein_38 incFII family plasmid replication initiator RepA -
M2894_RS25745 (M2894_25745) 39912..40196 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
M2894_RS25750 (M2894_25750) 40196..40471 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M2894_RS25755 (M2894_25755) 40540..40808 + 269 Protein_41 type II toxin-antitoxin system ParD family antitoxin -
M2894_RS25760 (M2894_25760) 40795..41085 + 291 Protein_42 type II toxin-antitoxin system RelE/ParE family toxin -
M2894_RS25765 (M2894_25765) 41178..41333 + 156 WP_044713270.1 hypothetical protein -
M2894_RS25770 (M2894_25770) 41454..42194 + 741 WP_001066951.1 tyrosine-type recombinase/integrase -
M2894_RS25775 (M2894_25775) 42473..43450 - 978 WP_001387465.1 RepB family plasmid replication initiator protein -
M2894_RS25780 (M2894_25780) 44536..44691 + 156 WP_000332512.1 transposase domain-containing protein -
M2894_RS25785 (M2894_25785) 44774..45175 - 402 WP_001392130.1 type II toxin-antitoxin system VapC family toxin -
M2894_RS25790 (M2894_25790) 45199..45429 - 231 WP_001261288.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - aggD / aggC / aggB / aggA / aap/aspU 1..75597 75597


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T244336 WP_000421257.1 NZ_CP096978:40196-40471 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT244336 WP_001387467.1 NZ_CP096978:39912-40196 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References