Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4753832..4754633 | Replicon | chromosome |
Accession | NZ_CP096976 | ||
Organism | Escherichia coli strain 17-07187 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D3GUT5 |
Locus tag | M2894_RS23265 | Protein ID | WP_001094430.1 |
Coordinates | 4754256..4754633 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | D3GUT4 |
Locus tag | M2894_RS23260 | Protein ID | WP_001285620.1 |
Coordinates | 4753832..4754209 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2894_RS23230 (4749033) | 4749033..4750542 | - | 1510 | Protein_4549 | group II intron reverse transcriptase/maturase | - |
M2894_RS23235 (4751216) | 4751216..4751956 | - | 741 | Protein_4550 | IS3 family transposase | - |
M2894_RS23240 (4752013) | 4752013..4752138 | + | 126 | Protein_4551 | DUF945 domain-containing protein | - |
M2894_RS23245 (4752480) | 4752480..4752953 | + | 474 | WP_000855057.1 | antirestriction protein | - |
M2894_RS23250 (4752969) | 4752969..4753444 | + | 476 | Protein_4553 | RadC family protein | - |
M2894_RS23255 (4753531) | 4753531..4753752 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
M2894_RS23260 (4753832) | 4753832..4754209 | + | 378 | WP_001285620.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
M2894_RS23265 (4754256) | 4754256..4754633 | + | 378 | WP_001094430.1 | TA system toxin CbtA family protein | Toxin |
M2894_RS23270 (4754630) | 4754630..4755118 | + | 489 | WP_000761715.1 | DUF5983 family protein | - |
M2894_RS23275 (4755138) | 4755138..4755335 | + | 198 | WP_000772029.1 | DUF957 domain-containing protein | - |
M2894_RS23280 (4755420) | 4755420..4756262 | + | 843 | WP_001290187.1 | DUF4942 domain-containing protein | - |
M2894_RS23285 (4757011) | 4757011..4758549 | + | 1539 | WP_001187182.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13971.82 Da Isoelectric Point: 6.8608
>T244332 WP_001094430.1 NZ_CP096976:4754256-4754633 [Escherichia coli]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13698.52 Da Isoelectric Point: 5.9505
>AT244332 WP_001285620.1 NZ_CP096976:4753832-4754209 [Escherichia coli]
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6M7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 2INW | |
AlphaFold DB | A0A0E0Y522 |