Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3952222..3953059 | Replicon | chromosome |
Accession | NZ_CP096976 | ||
Organism | Escherichia coli strain 17-07187 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | M2894_RS19430 | Protein ID | WP_000227784.1 |
Coordinates | 3952517..3953059 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | M2894_RS19425 | Protein ID | WP_001297137.1 |
Coordinates | 3952222..3952533 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2894_RS19400 (3947242) | 3947242..3948189 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
M2894_RS19405 (3948211) | 3948211..3950202 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
M2894_RS19410 (3950192) | 3950192..3950806 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
M2894_RS19415 (3950806) | 3950806..3951135 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
M2894_RS19420 (3951147) | 3951147..3952037 | + | 891 | WP_000971336.1 | heme o synthase | - |
M2894_RS19425 (3952222) | 3952222..3952533 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
M2894_RS19430 (3952517) | 3952517..3953059 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
M2894_RS19435 (3953115) | 3953115..3954050 | - | 936 | WP_024174603.1 | tetratricopeptide repeat protein | - |
M2894_RS19440 (3954458) | 3954458..3955822 | + | 1365 | WP_001000974.1 | MFS transporter | - |
M2894_RS19445 (3955950) | 3955950..3956441 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
M2894_RS19450 (3956609) | 3956609..3957520 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T244329 WP_000227784.1 NZ_CP096976:3952517-3953059 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|