Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3918145..3918763 | Replicon | chromosome |
Accession | NZ_CP096976 | ||
Organism | Escherichia coli strain 17-07187 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M2894_RS19260 | Protein ID | WP_001291435.1 |
Coordinates | 3918545..3918763 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M2894_RS19255 | Protein ID | WP_000344800.1 |
Coordinates | 3918145..3918519 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2894_RS19245 (3913234) | 3913234..3914427 | + | 1194 | WP_001386618.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M2894_RS19250 (3914450) | 3914450..3917599 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
M2894_RS19255 (3918145) | 3918145..3918519 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M2894_RS19260 (3918545) | 3918545..3918763 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M2894_RS19265 (3918934) | 3918934..3919485 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
M2894_RS19270 (3919601) | 3919601..3920071 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M2894_RS19275 (3920235) | 3920235..3921785 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M2894_RS19280 (3921827) | 3921827..3922180 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
M2894_RS19290 (3922559) | 3922559..3922870 | + | 312 | WP_000409911.1 | MGMT family protein | - |
M2894_RS19295 (3922901) | 3922901..3923473 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244328 WP_001291435.1 NZ_CP096976:3918545-3918763 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT244328 WP_000344800.1 NZ_CP096976:3918145-3918519 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |