Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2004622..2005457 | Replicon | chromosome |
| Accession | NZ_CP096976 | ||
| Organism | Escherichia coli strain 17-07187 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | M2894_RS09565 | Protein ID | WP_170903253.1 |
| Coordinates | 2004622..2004999 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | M2894_RS09570 | Protein ID | WP_063115597.1 |
| Coordinates | 2005089..2005457 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2894_RS09530 (1999922) | 1999922..2000287 | - | 366 | WP_001282181.1 | EutP/PduV family microcompartment system protein | - |
| M2894_RS09535 (2000559) | 2000559..2000948 | - | 390 | WP_170903232.1 | transposase | - |
| M2894_RS09540 (2001072) | 2001072..2001506 | + | 435 | WP_001309734.1 | transposase | - |
| M2894_RS09545 (2001503) | 2001503..2001853 | + | 351 | WP_000624688.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M2894_RS09550 (2001884) | 2001884..2003498 | + | 1615 | Protein_1867 | IS66-like element ISEc43 family transposase | - |
| M2894_RS09555 (2004296) | 2004296..2004376 | - | 81 | Protein_1868 | hypothetical protein | - |
| M2894_RS09560 (2004476) | 2004476..2004625 | - | 150 | Protein_1869 | DUF5983 family protein | - |
| M2894_RS09565 (2004622) | 2004622..2004999 | - | 378 | WP_170903253.1 | TA system toxin CbtA family protein | Toxin |
| M2894_RS09570 (2005089) | 2005089..2005457 | - | 369 | WP_063115597.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M2894_RS09575 (2005620) | 2005620..2005840 | - | 221 | Protein_1872 | DUF987 domain-containing protein | - |
| M2894_RS09580 (2005903) | 2005903..2006379 | - | 477 | WP_001186774.1 | RadC family protein | - |
| M2894_RS09585 (2006395) | 2006395..2006874 | - | 480 | WP_000844095.1 | antirestriction protein | - |
| M2894_RS09590 (2006956) | 2006956..2007774 | - | 819 | WP_228355557.1 | DUF932 domain-containing protein | - |
| M2894_RS09595 (2007892) | 2007892..2008087 | - | 196 | Protein_1876 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2000559..2044522 | 43963 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14211.22 Da Isoelectric Point: 6.9482
>T244317 WP_170903253.1 NZ_CP096976:c2004999-2004622 [Escherichia coli]
MKTLPDTHVREVSCCPSLVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDEVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSLVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDEVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13583.30 Da Isoelectric Point: 5.9598
>AT244317 WP_063115597.1 NZ_CP096976:c2005457-2005089 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTSETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|