Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 906230..907031 Replicon chromosome
Accession NZ_CP096976
Organism Escherichia coli strain 17-07187

Toxin (Protein)


Gene name yeeV Uniprot ID D3GU15
Locus tag M2894_RS04385 Protein ID WP_001094429.1
Coordinates 906230..906607 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0E0XUQ1
Locus tag M2894_RS04390 Protein ID WP_001285616.1
Coordinates 906654..907031 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2894_RS04350 (901311) 901311..901910 + 600 WP_001255040.1 type II secretion system minor pseudopilin GspJ -
M2894_RS04355 (901913) 901913..902890 + 978 WP_000633238.1 type II secretion system minor pseudopilin GspK -
M2894_RS04360 (902887) 902887..904065 + 1179 WP_000094962.1 type II secretion system protein GspL -
M2894_RS04365 (904067) 904067..904603 + 537 WP_000942795.1 GspM family type II secretion system protein YghD -
M2894_RS04370 (904884) 904884..905726 - 843 WP_001280493.1 DUF4942 domain-containing protein -
M2894_RS04375 (905811) 905811..906008 - 198 WP_085949090.1 DUF957 domain-containing protein -
M2894_RS04380 (906036) 906036..906233 - 198 Protein_856 DUF5983 family protein -
M2894_RS04385 (906230) 906230..906607 - 378 WP_001094429.1 TA system toxin CbtA family protein Toxin
M2894_RS04390 (906654) 906654..907031 - 378 WP_001285616.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M2894_RS04395 (907111) 907111..907332 - 222 WP_000692350.1 DUF987 domain-containing protein -
M2894_RS04400 (907419) 907419..907895 - 477 WP_001388380.1 RadC family protein -
M2894_RS04405 (907911) 907911..908384 - 474 WP_000855081.1 antirestriction protein -
M2894_RS04410 (908686) 908686..909504 - 819 WP_001234603.1 DUF932 domain-containing protein -
M2894_RS04415 (909604) 909604..909837 - 234 WP_001119729.1 DUF905 family protein -
M2894_RS04420 (909916) 909916..910371 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / vipA/tssB / vipB/tssC / clbK 809836..966356 156520


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13856.73 Da        Isoelectric Point: 6.8601

>T244312 WP_001094429.1 NZ_CP096976:c906607-906230 [Escherichia coli]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13747.65 Da        Isoelectric Point: 6.6240

>AT244312 WP_001285616.1 NZ_CP096976:c907031-906654 [Escherichia coli]
VSDTLPGTTPPDDNHDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTMTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0XVU5

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0XUQ1

References