Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 137896..138697 | Replicon | chromosome |
Accession | NZ_CP096976 | ||
Organism | Escherichia coli strain 17-07187 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
Locus tag | M2894_RS00680 | Protein ID | WP_001094437.1 |
Coordinates | 137896..138273 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
Locus tag | M2894_RS00685 | Protein ID | WP_001390338.1 |
Coordinates | 138320..138697 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2894_RS00650 (133253) | 133253..134176 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
M2894_RS00655 (134287) | 134287..135471 | - | 1185 | WP_001172875.1 | sugar efflux transporter | - |
M2894_RS00660 (135868) | 135868..136029 | - | 162 | Protein_125 | RhuM family protein | - |
M2894_RS00665 (136264) | 136264..137109 | - | 846 | WP_001274561.1 | DUF4942 domain-containing protein | - |
M2894_RS00670 (137194) | 137194..137391 | - | 198 | WP_000772032.1 | DUF957 domain-containing protein | - |
M2894_RS00675 (137411) | 137411..137899 | - | 489 | WP_000761716.1 | DUF5983 family protein | - |
M2894_RS00680 (137896) | 137896..138273 | - | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
M2894_RS00685 (138320) | 138320..138697 | - | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M2894_RS00690 (138860) | 138860..138982 | - | 123 | Protein_131 | DUF987 family protein | - |
M2894_RS00695 (139033) | 139033..139730 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
M2894_RS00700 (139849) | 139849..141033 | - | 1185 | WP_001218908.1 | tyrosine-type recombinase/integrase | - |
M2894_RS00710 (141720) | 141720..143102 | + | 1383 | WP_000834439.1 | glycoside-pentoside-hexuronide family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 139353..139730 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T244309 WP_001094437.1 NZ_CP096976:c138273-137896 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT244309 WP_001390338.1 NZ_CP096976:c138697-138320 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XS49 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XTQ1 |