Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 928861..929432 Replicon chromosome
Accession NZ_CP096973
Organism Halomonas sp. ZZQ-149

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag M0220_RS04315 Protein ID WP_030069604.1
Coordinates 928861..929262 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag M0220_RS04320 Protein ID WP_030069602.1
Coordinates 929262..929432 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M0220_RS04295 (M0220_04280) 924441..925613 + 1173 WP_030069612.1 UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase -
M0220_RS04300 (M0220_04285) 925691..926887 + 1197 WP_030069610.1 homoserine O-acetyltransferase -
M0220_RS04305 (M0220_04290) 927071..927724 - 654 WP_030069608.1 DsbA family oxidoreductase -
M0220_RS04310 (M0220_04295) 927836..928798 - 963 WP_264018783.1 ribonuclease Z -
M0220_RS04315 (M0220_04300) 928861..929262 - 402 WP_030069604.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M0220_RS04320 (M0220_04305) 929262..929432 - 171 WP_030069602.1 hypothetical protein Antitoxin
M0220_RS04325 (M0220_04310) 929490..929648 - 159 Protein_838 MBL fold metallo-hydrolase -
M0220_RS04330 (M0220_04315) 929767..930060 - 294 WP_030069600.1 HigA family addiction module antitoxin -
M0220_RS04335 (M0220_04320) 930060..930338 - 279 WP_030069598.1 type II toxin-antitoxin system RelE/ParE family toxin -
M0220_RS04340 (M0220_04325) 930537..930800 - 264 WP_030069596.1 Txe/YoeB family addiction module toxin -
M0220_RS04345 (M0220_04330) 930793..931047 - 255 WP_030069594.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
M0220_RS04350 (M0220_04335) 931407..931631 - 225 WP_264018784.1 Txe/YoeB family addiction module toxin -
M0220_RS04355 (M0220_04340) 931628..931870 - 243 Protein_844 type II toxin-antitoxin system Phd/YefM family antitoxin -
M0220_RS04360 (M0220_04345) 932015..932398 - 384 WP_264018785.1 hypothetical protein -
M0220_RS04365 (M0220_04350) 932554..933420 - 867 WP_264018786.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-131)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14555.45 Da        Isoelectric Point: 3.9709

>T244306 WP_030069604.1 NZ_CP096973:c929262-928861 [Halomonas sp. ZZQ-149]
MNLIFFPFERVLEINIFILEHEPGMKGAADINKLQGALGRVDNAIAYSGLDDVFEIAAKYVASIALSHSLPDANKRTGLA
VGLEYLSLNDFELTADNELFADAVKDLVIGAIDESDFADLLYAQYAAEQDNKL

Download         Length: 402 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6300.52 Da        Isoelectric Point: 11.0432

>AT244306 WP_030069602.1 NZ_CP096973:c929432-929262 [Halomonas sp. ZZQ-149]
MNTKIEAYGVKAVKRPKIVASKKLDLSGESGQQIVKSETKLVLRTHKRTFKKLADM

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References