Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc(toxin) |
| Location | 928861..929432 | Replicon | chromosome |
| Accession | NZ_CP096973 | ||
| Organism | Halomonas sp. ZZQ-149 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | M0220_RS04315 | Protein ID | WP_030069604.1 |
| Coordinates | 928861..929262 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | M0220_RS04320 | Protein ID | WP_030069602.1 |
| Coordinates | 929262..929432 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0220_RS04295 (M0220_04280) | 924441..925613 | + | 1173 | WP_030069612.1 | UbiH/UbiF/VisC/COQ6 family ubiquinone biosynthesis hydroxylase | - |
| M0220_RS04300 (M0220_04285) | 925691..926887 | + | 1197 | WP_030069610.1 | homoserine O-acetyltransferase | - |
| M0220_RS04305 (M0220_04290) | 927071..927724 | - | 654 | WP_030069608.1 | DsbA family oxidoreductase | - |
| M0220_RS04310 (M0220_04295) | 927836..928798 | - | 963 | WP_264018783.1 | ribonuclease Z | - |
| M0220_RS04315 (M0220_04300) | 928861..929262 | - | 402 | WP_030069604.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M0220_RS04320 (M0220_04305) | 929262..929432 | - | 171 | WP_030069602.1 | hypothetical protein | Antitoxin |
| M0220_RS04325 (M0220_04310) | 929490..929648 | - | 159 | Protein_838 | MBL fold metallo-hydrolase | - |
| M0220_RS04330 (M0220_04315) | 929767..930060 | - | 294 | WP_030069600.1 | HigA family addiction module antitoxin | - |
| M0220_RS04335 (M0220_04320) | 930060..930338 | - | 279 | WP_030069598.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M0220_RS04340 (M0220_04325) | 930537..930800 | - | 264 | WP_030069596.1 | Txe/YoeB family addiction module toxin | - |
| M0220_RS04345 (M0220_04330) | 930793..931047 | - | 255 | WP_030069594.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| M0220_RS04350 (M0220_04335) | 931407..931631 | - | 225 | WP_264018784.1 | Txe/YoeB family addiction module toxin | - |
| M0220_RS04355 (M0220_04340) | 931628..931870 | - | 243 | Protein_844 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| M0220_RS04360 (M0220_04345) | 932015..932398 | - | 384 | WP_264018785.1 | hypothetical protein | - |
| M0220_RS04365 (M0220_04350) | 932554..933420 | - | 867 | WP_264018786.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14555.45 Da Isoelectric Point: 3.9709
>T244306 WP_030069604.1 NZ_CP096973:c929262-928861 [Halomonas sp. ZZQ-149]
MNLIFFPFERVLEINIFILEHEPGMKGAADINKLQGALGRVDNAIAYSGLDDVFEIAAKYVASIALSHSLPDANKRTGLA
VGLEYLSLNDFELTADNELFADAVKDLVIGAIDESDFADLLYAQYAAEQDNKL
MNLIFFPFERVLEINIFILEHEPGMKGAADINKLQGALGRVDNAIAYSGLDDVFEIAAKYVASIALSHSLPDANKRTGLA
VGLEYLSLNDFELTADNELFADAVKDLVIGAIDESDFADLLYAQYAAEQDNKL
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|