Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2745871..2746501 | Replicon | chromosome |
| Accession | NZ_CP096972 | ||
| Organism | Sphingomonas sp. SUN039 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | M0209_RS13405 | Protein ID | WP_258888770.1 |
| Coordinates | 2745871..2746236 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | M0209_RS13410 | Protein ID | WP_258888771.1 |
| Coordinates | 2746217..2746501 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0209_RS13385 (M0209_13365) | 2741573..2742082 | - | 510 | WP_258888766.1 | hypothetical protein | - |
| M0209_RS13390 (M0209_13370) | 2742082..2742483 | - | 402 | WP_258888767.1 | VOC family protein | - |
| M0209_RS13395 (M0209_13375) | 2742642..2743583 | + | 942 | WP_258888768.1 | SMI1/KNR4 family protein | - |
| M0209_RS13400 (M0209_13380) | 2743614..2745803 | + | 2190 | WP_258888769.1 | excinuclease ABC subunit UvrB | - |
| M0209_RS13405 (M0209_13385) | 2745871..2746236 | + | 366 | WP_258888770.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M0209_RS13410 (M0209_13390) | 2746217..2746501 | + | 285 | WP_258888771.1 | putative addiction module antidote protein | Antitoxin |
| M0209_RS13415 (M0209_13395) | 2746558..2747244 | + | 687 | WP_258888772.1 | 2OG-Fe(II) oxygenase | - |
| M0209_RS13420 (M0209_13400) | 2747270..2747767 | - | 498 | WP_258888773.1 | hypothetical protein | - |
| M0209_RS13425 (M0209_13405) | 2747819..2748397 | - | 579 | WP_258888774.1 | SURF1 family protein | - |
| M0209_RS13430 (M0209_13410) | 2748448..2748813 | - | 366 | WP_258888775.1 | DUF983 domain-containing protein | - |
| M0209_RS13435 (M0209_13415) | 2748823..2749326 | - | 504 | WP_258888776.1 | DUF3291 domain-containing protein | - |
| M0209_RS13440 (M0209_13420) | 2749327..2750211 | - | 885 | WP_258888777.1 | cytochrome c oxidase subunit 3 | - |
| M0209_RS13445 (M0209_13425) | 2750254..2750793 | - | 540 | WP_258888778.1 | cytochrome c oxidase assembly protein | - |
| M0209_RS13450 (M0209_13430) | 2750793..2750933 | - | 141 | WP_258888779.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13446.37 Da Isoelectric Point: 9.0687
>T244303 WP_258888770.1 NZ_CP096972:2745871-2746236 [Sphingomonas sp. SUN039]
MAFDVDAMTNVLYEGHKFRVAQTAAFSEWLPLLRDRRALAKITDRLLRAADGNFGDVKSAGSGISEMRIDYGPGYRVYFC
QRGTEIVILLCGGGKRTQQRDIANAKRLKAEIEFSDGTSPL
MAFDVDAMTNVLYEGHKFRVAQTAAFSEWLPLLRDRRALAKITDRLLRAADGNFGDVKSAGSGISEMRIDYGPGYRVYFC
QRGTEIVILLCGGGKRTQQRDIANAKRLKAEIEFSDGTSPL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|