Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2052228..2052886 | Replicon | chromosome |
| Accession | NZ_CP096972 | ||
| Organism | Sphingomonas sp. SUN039 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M0209_RS09995 | Protein ID | WP_258888129.1 |
| Coordinates | 2052228..2052659 (-) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M0209_RS10000 | Protein ID | WP_258888130.1 |
| Coordinates | 2052656..2052886 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0209_RS09980 (M0209_09965) | 2047934..2049901 | + | 1968 | WP_258888127.1 | ATP-binding protein | - |
| M0209_RS09985 (M0209_09970) | 2049939..2051132 | + | 1194 | WP_258888128.1 | LPS export ABC transporter permease LptF | - |
| M0209_RS09990 (M0209_09975) | 2051129..2052226 | + | 1098 | WP_258889614.1 | LPS export ABC transporter permease LptG | - |
| M0209_RS09995 (M0209_09980) | 2052228..2052659 | - | 432 | WP_258888129.1 | PIN domain-containing protein | Toxin |
| M0209_RS10000 (M0209_09985) | 2052656..2052886 | - | 231 | WP_258888130.1 | hypothetical protein | Antitoxin |
| M0209_RS10005 (M0209_09990) | 2052931..2054043 | - | 1113 | WP_258888131.1 | fatty acid desaturase | - |
| M0209_RS10010 (M0209_09995) | 2054066..2055298 | + | 1233 | WP_258888132.1 | N-acetyltransferase | - |
| M0209_RS10015 (M0209_10000) | 2055300..2056055 | + | 756 | WP_258888133.1 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
| M0209_RS10020 (M0209_10005) | 2056052..2056276 | - | 225 | WP_258888134.1 | hypothetical protein | - |
| M0209_RS10025 (M0209_10010) | 2056303..2057073 | - | 771 | WP_258889615.1 | exodeoxyribonuclease III | - |
| M0209_RS10030 (M0209_10015) | 2057073..2057399 | - | 327 | WP_258888135.1 | iron-sulfur cluster insertion protein ErpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15925.04 Da Isoelectric Point: 6.3969
>T244302 WP_258888129.1 NZ_CP096972:c2052659-2052228 [Sphingomonas sp. SUN039]
MSRALLDVNVLLALLDPMHIDHERAQDWFADARFDGWATCPITQNGYLRIATQPGYTNPVSVADAIDLLDHFTSQSAHEF
WPASGSLLDRAFCDVLKIPSHRHMTDTYLLALARHHGGRLATLDRRLNINAVAEGSQHLTIIG
MSRALLDVNVLLALLDPMHIDHERAQDWFADARFDGWATCPITQNGYLRIATQPGYTNPVSVADAIDLLDHFTSQSAHEF
WPASGSLLDRAFCDVLKIPSHRHMTDTYLLALARHHGGRLATLDRRLNINAVAEGSQHLTIIG
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|