Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1769359..1769993 | Replicon | chromosome |
Accession | NZ_CP096972 | ||
Organism | Sphingomonas sp. SUN039 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M0209_RS08640 | Protein ID | WP_258887876.1 |
Coordinates | 1769359..1769760 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M0209_RS08645 | Protein ID | WP_258889603.1 |
Coordinates | 1769772..1769993 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M0209_RS08610 (M0209_08600) | 1765403..1766635 | + | 1233 | WP_258887871.1 | DNA sulfur modification protein DndB | - |
M0209_RS08615 (M0209_08605) | 1766839..1767171 | - | 333 | WP_258887872.1 | Grx4 family monothiol glutaredoxin | - |
M0209_RS08620 (M0209_08610) | 1767178..1767411 | - | 234 | WP_258887873.1 | BolA/IbaG family iron-sulfur metabolism protein | - |
M0209_RS08625 (M0209_08615) | 1767411..1767734 | - | 324 | WP_258887874.1 | DUF1476 domain-containing protein | - |
M0209_RS08630 (M0209_08620) | 1767768..1768766 | - | 999 | WP_258889602.1 | NADPH:quinone oxidoreductase family protein | - |
M0209_RS08635 (M0209_08625) | 1768763..1769362 | - | 600 | WP_258887875.1 | 3-isopropylmalate dehydratase small subunit | - |
M0209_RS08640 (M0209_08630) | 1769359..1769760 | - | 402 | WP_258887876.1 | PIN domain-containing protein | Toxin |
M0209_RS08645 (M0209_08635) | 1769772..1769993 | - | 222 | WP_258889603.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M0209_RS08650 (M0209_08640) | 1770083..1770367 | + | 285 | WP_258887877.1 | helix-turn-helix transcriptional regulator | - |
M0209_RS08655 (M0209_08645) | 1770423..1770830 | + | 408 | WP_258887878.1 | hypothetical protein | - |
M0209_RS08660 (M0209_08650) | 1770835..1772268 | - | 1434 | WP_258887879.1 | 3-isopropylmalate dehydratase large subunit | - |
M0209_RS08665 (M0209_08655) | 1772277..1773176 | - | 900 | WP_258887880.1 | alpha/beta hydrolase | - |
M0209_RS08670 (M0209_08660) | 1773220..1774506 | - | 1287 | WP_258887881.1 | serine hydrolase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14753.78 Da Isoelectric Point: 5.6238
>T244301 WP_258887876.1 NZ_CP096972:c1769760-1769359 [Sphingomonas sp. SUN039]
MLDTNVCIRVIRNRPAAVAARFQSEVDDLAISTIVWHELLHGAEKSDRPAYHREKAEDFATRLTILNFDQAAAADAANIK
FVLGKKGQMIGPNDLLIAGHARSLGLQLITGNLGEFRRVDGLRCEDWLAEETE
MLDTNVCIRVIRNRPAAVAARFQSEVDDLAISTIVWHELLHGAEKSDRPAYHREKAEDFATRLTILNFDQAAAADAANIK
FVLGKKGQMIGPNDLLIAGHARSLGLQLITGNLGEFRRVDGLRCEDWLAEETE
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|