Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 786911..787485 | Replicon | chromosome |
Accession | NZ_CP096972 | ||
Organism | Sphingomonas sp. SUN039 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M0209_RS03925 | Protein ID | WP_258886998.1 |
Coordinates | 787117..787485 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M0209_RS03920 | Protein ID | WP_258886997.1 |
Coordinates | 786911..787120 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M0209_RS03890 (M0209_03880) | 782046..782783 | - | 738 | WP_258886991.1 | tRNA pseudouridine(38-40) synthase TruA | - |
M0209_RS03895 (M0209_03885) | 782793..783692 | - | 900 | WP_258886992.1 | methionyl-tRNA formyltransferase | - |
M0209_RS03900 (M0209_03890) | 783806..784402 | + | 597 | WP_258886993.1 | recombination mediator RecR | - |
M0209_RS03905 (M0209_03895) | 784418..784777 | + | 360 | WP_258886994.1 | VOC family protein | - |
M0209_RS03910 (M0209_03900) | 784810..785346 | + | 537 | WP_258886995.1 | peptide deformylase | - |
M0209_RS03915 (M0209_03905) | 785514..786911 | + | 1398 | WP_258886996.1 | DNA recombination protein RmuC | - |
M0209_RS03920 (M0209_03910) | 786911..787120 | + | 210 | WP_258886997.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M0209_RS03925 (M0209_03915) | 787117..787485 | + | 369 | WP_258886998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M0209_RS03930 (M0209_03920) | 787459..788268 | - | 810 | WP_258886999.1 | RNA methyltransferase | - |
M0209_RS03935 (M0209_03925) | 788273..788539 | - | 267 | WP_258887000.1 | HPr family phosphocarrier protein | - |
M0209_RS03940 (M0209_03930) | 788536..788955 | - | 420 | WP_258887001.1 | PTS sugar transporter subunit IIA | - |
M0209_RS03945 (M0209_03935) | 788952..789893 | - | 942 | WP_258887002.1 | RNase adapter RapZ | - |
M0209_RS03950 (M0209_03940) | 789890..790327 | - | 438 | WP_258889554.1 | HPr kinase/phosphatase C-terminal domain-containing protein | - |
M0209_RS03955 (M0209_03945) | 790345..791874 | - | 1530 | WP_258887003.1 | sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13169.24 Da Isoelectric Point: 4.8261
>T244300 WP_258886998.1 NZ_CP096972:787117-787485 [Sphingomonas sp. SUN039]
MILADTCIWADYIDRGDYSLAALLENGAVVTHPFVVAEVLLGNLADRKMWKDQLARLPEFLPVRHSDVMALIDAAELGGS
GVGYVDAHLLAAVLARPGTAIWTRDKKLNRVAGELGVAFEPA
MILADTCIWADYIDRGDYSLAALLENGAVVTHPFVVAEVLLGNLADRKMWKDQLARLPEFLPVRHSDVMALIDAAELGGS
GVGYVDAHLLAAVLARPGTAIWTRDKKLNRVAGELGVAFEPA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|