Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 360749..361193 | Replicon | chromosome |
| Accession | NZ_CP096972 | ||
| Organism | Sphingomonas sp. SUN039 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M0209_RS01800 | Protein ID | WP_258886496.1 |
| Coordinates | 360749..361024 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M0209_RS01805 | Protein ID | WP_258886498.1 |
| Coordinates | 361017..361193 (-) | Length | 59 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0209_RS01770 (M0209_01760) | 355866..356072 | + | 207 | WP_258886482.1 | HigA family addiction module antitoxin | - |
| M0209_RS01775 (M0209_01765) | 356077..356733 | - | 657 | WP_258886484.1 | hypothetical protein | - |
| M0209_RS01780 (M0209_01770) | 356753..357121 | - | 369 | WP_258886486.1 | helix-turn-helix domain-containing protein | - |
| M0209_RS01785 (M0209_01775) | 357118..357468 | - | 351 | WP_258886487.1 | DUF6516 family protein | - |
| M0209_RS01790 (M0209_01780) | 357497..359791 | - | 2295 | WP_258886489.1 | UvrD-helicase domain-containing protein | - |
| M0209_RS01795 (M0209_01785) | 359802..360728 | - | 927 | WP_258886494.1 | DMT family transporter | - |
| M0209_RS01800 (M0209_01790) | 360749..361024 | - | 276 | WP_258886496.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M0209_RS01805 (M0209_01795) | 361017..361193 | - | 177 | WP_258886498.1 | stability determinant | Antitoxin |
| M0209_RS01810 (M0209_01800) | 361222..362481 | + | 1260 | WP_258886500.1 | MFS transporter | - |
| M0209_RS01815 (M0209_01805) | 362471..362926 | + | 456 | WP_258886502.1 | GNAT family N-acetyltransferase | - |
| M0209_RS01820 (M0209_01810) | 362917..363465 | - | 549 | WP_258886508.1 | 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD | - |
| M0209_RS01825 (M0209_01815) | 363801..364505 | - | 705 | Protein_354 | rRNA pseudouridine synthase | - |
| M0209_RS01830 (M0209_01820) | 364529..365698 | - | 1170 | WP_258889537.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10617.26 Da Isoelectric Point: 6.9773
>T244299 WP_258886496.1 NZ_CP096972:c361024-360749 [Sphingomonas sp. SUN039]
MLELVWEPLATEQLSAIIEYIAQHNFPAAERLERQIHAKVELACHVPGMGRPGRVSETREIVAHPNYLVIYRVTDERLYV
IRVLHSRQQYP
MLELVWEPLATEQLSAIIEYIAQHNFPAAERLERQIHAKVELACHVPGMGRPGRVSETREIVAHPNYLVIYRVTDERLYV
IRVLHSRQQYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|