Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 3153153..3153811 | Replicon | chromosome |
Accession | NZ_CP096971 | ||
Organism | Sphingomonas sp. SUN019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M0208_RS15185 | Protein ID | WP_258892511.1 |
Coordinates | 3153153..3153548 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M0208_RS15190 | Protein ID | WP_258892512.1 |
Coordinates | 3153545..3153811 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M0208_RS15160 (M0208_15130) | 3148481..3149473 | - | 993 | WP_258892506.1 | aldo/keto reductase | - |
M0208_RS15165 (M0208_15135) | 3149470..3150738 | - | 1269 | WP_258892507.1 | dicarboxylate/amino acid:cation symporter | - |
M0208_RS15170 (M0208_15140) | 3150820..3152160 | + | 1341 | WP_258892508.1 | phosphoglucosamine mutase | - |
M0208_RS15175 (M0208_15145) | 3152224..3152607 | - | 384 | WP_258892509.1 | hypothetical protein | - |
M0208_RS15180 (M0208_15150) | 3152668..3153156 | - | 489 | WP_258892510.1 | DNA-deoxyinosine glycosylase | - |
M0208_RS15185 (M0208_15155) | 3153153..3153548 | - | 396 | WP_258892511.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M0208_RS15190 (M0208_15160) | 3153545..3153811 | - | 267 | WP_258892512.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
M0208_RS15195 (M0208_15165) | 3153913..3154893 | + | 981 | WP_258892513.1 | cysteine synthase A | - |
M0208_RS15200 (M0208_15170) | 3154941..3155240 | + | 300 | WP_258892514.1 | hypothetical protein | - |
M0208_RS15205 (M0208_15175) | 3155551..3156051 | + | 501 | WP_258892515.1 | division/cell wall cluster transcriptional repressor MraZ | - |
M0208_RS15210 (M0208_15180) | 3156048..3157019 | + | 972 | WP_258892516.1 | 16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH | - |
M0208_RS15215 (M0208_15185) | 3157016..3157654 | + | 639 | WP_258892517.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14378.42 Da Isoelectric Point: 4.4687
>T244298 WP_258892511.1 NZ_CP096971:c3153548-3153153 [Sphingomonas sp. SUN019]
MIVDTSALMAIILGEPERDLFIAILASADTLSISAGSWVELGAVIVRRQQHMLEHELLALRDDFEFGVEPVTVIQADLAR
VAYREYGRGTGHPAKLNFGDCFAYALARETGEPLLFKGNDFSQTDINPAVK
MIVDTSALMAIILGEPERDLFIAILASADTLSISAGSWVELGAVIVRRQQHMLEHELLALRDDFEFGVEPVTVIQADLAR
VAYREYGRGTGHPAKLNFGDCFAYALARETGEPLLFKGNDFSQTDINPAVK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|