Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 31091..31761 | Replicon | chromosome |
| Accession | NZ_CP096971 | ||
| Organism | Sphingomonas sp. SUN019 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M0208_RS00150 | Protein ID | WP_258889732.1 |
| Coordinates | 31345..31761 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M0208_RS00145 | Protein ID | WP_258889731.1 |
| Coordinates | 31091..31348 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M0208_RS00115 (M0208_00115) | 26099..26578 | - | 480 | WP_258889725.1 | 50S ribosomal protein L13 | - |
| M0208_RS00120 (M0208_00120) | 26710..27750 | - | 1041 | WP_258889726.1 | COX15/CtaA family protein | - |
| M0208_RS00125 (M0208_00125) | 27851..28231 | + | 381 | WP_258889727.1 | MerC domain-containing protein | - |
| M0208_RS00130 (M0208_00130) | 28270..28743 | + | 474 | WP_258889728.1 | transcriptional repressor | - |
| M0208_RS00135 (M0208_00135) | 28798..30717 | + | 1920 | WP_258889729.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
| M0208_RS00140 (M0208_00140) | 30728..31048 | + | 321 | WP_258889730.1 | hypothetical protein | - |
| M0208_RS00145 (M0208_00145) | 31091..31348 | + | 258 | WP_258889731.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M0208_RS00150 (M0208_00150) | 31345..31761 | + | 417 | WP_258889732.1 | PIN domain-containing protein | Toxin |
| M0208_RS00155 (M0208_00155) | 31751..32422 | - | 672 | WP_258889733.1 | alpha/beta hydrolase | - |
| M0208_RS00160 (M0208_00160) | 32600..33334 | + | 735 | WP_258889734.1 | TlyA family RNA methyltransferase | - |
| M0208_RS00165 (M0208_00165) | 33462..33983 | + | 522 | WP_258893127.1 | TspO/MBR family protein | - |
| M0208_RS00170 (M0208_00170) | 34009..34263 | + | 255 | WP_258889735.1 | accessory factor UbiK family protein | - |
| M0208_RS00175 (M0208_00175) | 34312..34815 | + | 504 | WP_258889736.1 | YbjN domain-containing protein | - |
| M0208_RS00180 (M0208_00180) | 34820..35617 | + | 798 | WP_258889737.1 | pyrroline-5-carboxylate reductase | - |
| M0208_RS00185 (M0208_00185) | 35614..36114 | - | 501 | WP_258889738.1 | MarR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15337.56 Da Isoelectric Point: 4.5984
>T244296 WP_258889732.1 NZ_CP096971:31345-31761 [Sphingomonas sp. SUN019]
MIATFFDSNVILYSTDRDERKAEIADALIGRGGWISVQVLNEIAHVARRKMQLDWDRVTDLIGTITGLTGVIDLTVELHN
LGRRVAERYKFSIYDGMIVAAALIADCDTLYSEDMHDGLVIDGRLRIVNPFAPDALTG
MIATFFDSNVILYSTDRDERKAEIADALIGRGGWISVQVLNEIAHVARRKMQLDWDRVTDLIGTITGLTGVIDLTVELHN
LGRRVAERYKFSIYDGMIVAAALIADCDTLYSEDMHDGLVIDGRLRIVNPFAPDALTG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|