Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142181..142686 | Replicon | chromosome |
Accession | NZ_CP096964 | ||
Organism | Pseudomonas aeruginosa strain NY13936 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M2J01_RS00650 | Protein ID | WP_003083773.1 |
Coordinates | 142181..142462 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M2J01_RS00655 | Protein ID | WP_003083775.1 |
Coordinates | 142459..142686 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J01_RS00625 (M2J01_00625) | 137246..138595 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
M2J01_RS00630 (M2J01_00630) | 138644..139330 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M2J01_RS00635 (M2J01_00635) | 139431..140165 | + | 735 | WP_003128333.1 | GntR family transcriptional regulator | - |
M2J01_RS00640 (M2J01_00640) | 140345..140755 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
M2J01_RS00645 (M2J01_00645) | 140787..141884 | - | 1098 | WP_283862876.1 | LysR substrate-binding domain-containing protein | - |
M2J01_RS00650 (M2J01_00650) | 142181..142462 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M2J01_RS00655 (M2J01_00655) | 142459..142686 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M2J01_RS00660 (M2J01_00660) | 142862..143482 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M2J01_RS00665 (M2J01_00665) | 143583..144083 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
M2J01_RS00670 (M2J01_00670) | 144156..144497 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
M2J01_RS00675 (M2J01_00675) | 144579..146006 | - | 1428 | WP_003083784.1 | GABA permease | - |
M2J01_RS00680 (M2J01_00680) | 146175..147668 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244290 WP_003083773.1 NZ_CP096964:c142462-142181 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|