Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142227..142732 | Replicon | chromosome |
Accession | NZ_CP096961 | ||
Organism | Pseudomonas aeruginosa strain NY13932 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M2J00_RS00650 | Protein ID | WP_003083773.1 |
Coordinates | 142227..142508 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M2J00_RS00655 | Protein ID | WP_003083775.1 |
Coordinates | 142505..142732 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J00_RS00625 (M2J00_00625) | 137478..138827 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
M2J00_RS00630 (M2J00_00630) | 138876..139562 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M2J00_RS00635 (M2J00_00635) | 139663..140397 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
M2J00_RS00640 (M2J00_00640) | 140577..140987 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
M2J00_RS00645 (M2J00_00645) | 141019..141927 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M2J00_RS00650 (M2J00_00650) | 142227..142508 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M2J00_RS00655 (M2J00_00655) | 142505..142732 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M2J00_RS00660 (M2J00_00660) | 142908..143528 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M2J00_RS00665 (M2J00_00665) | 143629..144129 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
M2J00_RS00670 (M2J00_00670) | 144202..144543 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M2J00_RS00675 (M2J00_00675) | 144625..146052 | - | 1428 | WP_003083784.1 | GABA permease | - |
M2J00_RS00680 (M2J00_00680) | 146221..147714 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244282 WP_003083773.1 NZ_CP096961:c142508-142227 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|