Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 4218237..4219279 Replicon chromosome
Accession NZ_CP096960
Organism Pseudomonas aeruginosa strain NY11254

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag M2I99_RS19625 Protein ID WP_003153636.1
Coordinates 4218237..4218812 (-) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag M2I99_RS19630 Protein ID WP_003050245.1
Coordinates 4218809..4219279 (-) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2I99_RS19600 (M2I99_19545) 4214675..4215400 - 726 WP_003050273.1 CBASS effector endonuclease NucC -
M2I99_RS19605 (M2I99_19550) 4215439..4216341 - 903 WP_003090158.1 CBASS oligonucleotide cyclase -
M2I99_RS19610 (M2I99_19555) 4216341..4216841 - 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
M2I99_RS19615 (M2I99_19560) 4216838..4217308 - 471 WP_063305693.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
M2I99_RS19620 (M2I99_19565) 4217305..4218219 - 915 WP_016852809.1 AAA family ATPase -
M2I99_RS19625 (M2I99_19570) 4218237..4218812 - 576 WP_003153636.1 PIN domain-containing protein Toxin
M2I99_RS19630 (M2I99_19575) 4218809..4219279 - 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
M2I99_RS19635 (M2I99_19580) 4219483..4219866 + 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
M2I99_RS19640 (M2I99_19585) 4219863..4220096 + 234 WP_006226027.1 TIGR03758 family integrating conjugative element protein -
M2I99_RS19645 (M2I99_19590) 4220113..4220472 + 360 WP_003090173.1 TIGR03745 family integrating conjugative element membrane protein -
M2I99_RS19650 (M2I99_19595) 4220484..4220882 + 399 WP_003050133.1 TIGR03750 family conjugal transfer protein -
M2I99_RS19655 (M2I99_19600) 4220879..4221571 + 693 WP_003090182.1 TIGR03746 family integrating conjugative element protein -
M2I99_RS19660 (M2I99_19605) 4221568..4222479 + 912 WP_006226028.1 TIGR03749 family integrating conjugative element protein -
M2I99_RS19665 (M2I99_19610) 4222469..4223887 + 1419 WP_006226029.1 TIGR03752 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 4169841..4297232 127391


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T244278 WP_003153636.1 NZ_CP096960:c4218812-4218237 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT244278 WP_003050245.1 NZ_CP096960:c4219279-4218809 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References