Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 4218237..4219279 | Replicon | chromosome |
| Accession | NZ_CP096960 | ||
| Organism | Pseudomonas aeruginosa strain NY11254 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | M2I99_RS19625 | Protein ID | WP_003153636.1 |
| Coordinates | 4218237..4218812 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | M2I99_RS19630 | Protein ID | WP_003050245.1 |
| Coordinates | 4218809..4219279 (-) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I99_RS19600 (M2I99_19545) | 4214675..4215400 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
| M2I99_RS19605 (M2I99_19550) | 4215439..4216341 | - | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
| M2I99_RS19610 (M2I99_19555) | 4216341..4216841 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| M2I99_RS19615 (M2I99_19560) | 4216838..4217308 | - | 471 | WP_063305693.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| M2I99_RS19620 (M2I99_19565) | 4217305..4218219 | - | 915 | WP_016852809.1 | AAA family ATPase | - |
| M2I99_RS19625 (M2I99_19570) | 4218237..4218812 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| M2I99_RS19630 (M2I99_19575) | 4218809..4219279 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M2I99_RS19635 (M2I99_19580) | 4219483..4219866 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| M2I99_RS19640 (M2I99_19585) | 4219863..4220096 | + | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
| M2I99_RS19645 (M2I99_19590) | 4220113..4220472 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| M2I99_RS19650 (M2I99_19595) | 4220484..4220882 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| M2I99_RS19655 (M2I99_19600) | 4220879..4221571 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| M2I99_RS19660 (M2I99_19605) | 4221568..4222479 | + | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
| M2I99_RS19665 (M2I99_19610) | 4222469..4223887 | + | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4169841..4297232 | 127391 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T244278 WP_003153636.1 NZ_CP096960:c4218812-4218237 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT244278 WP_003050245.1 NZ_CP096960:c4219279-4218809 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|