Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 183906..184411 | Replicon | chromosome |
Accession | NZ_CP096960 | ||
Organism | Pseudomonas aeruginosa strain NY11254 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M2I99_RS00805 | Protein ID | WP_003083773.1 |
Coordinates | 183906..184187 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M2I99_RS00810 | Protein ID | WP_003083775.1 |
Coordinates | 184184..184411 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I99_RS00780 (M2I99_00780) | 179157..180506 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
M2I99_RS00785 (M2I99_00785) | 180555..181241 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M2I99_RS00790 (M2I99_00790) | 181342..182076 | + | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
M2I99_RS00795 (M2I99_00795) | 182256..182666 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
M2I99_RS00800 (M2I99_00800) | 182698..183606 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M2I99_RS00805 (M2I99_00805) | 183906..184187 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M2I99_RS00810 (M2I99_00810) | 184184..184411 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M2I99_RS00815 (M2I99_00815) | 184587..185207 | - | 621 | WP_003101226.1 | hypothetical protein | - |
M2I99_RS00820 (M2I99_00820) | 185308..185808 | + | 501 | WP_003083778.1 | LEA type 2 family protein | - |
M2I99_RS00825 (M2I99_00825) | 185881..186222 | + | 342 | WP_014603467.1 | zinc ribbon domain-containing protein YjdM | - |
M2I99_RS00830 (M2I99_00830) | 186304..187731 | - | 1428 | WP_003083784.1 | GABA permease | - |
M2I99_RS00835 (M2I99_00835) | 187900..189393 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244275 WP_003083773.1 NZ_CP096960:c184187-183906 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|