Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpB-mazE/PRK09812-ChpS |
| Location | 44792..45396 | Replicon | plasmid pNY11210-NR |
| Accession | NZ_CP096959 | ||
| Organism | Pseudomonas aeruginosa strain NY11210 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | M2I98_RS32375 | Protein ID | WP_045666096.1 |
| Coordinates | 44792..45151 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M2I98_RS32380 | Protein ID | WP_045666097.1 |
| Coordinates | 45148..45396 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I98_RS32335 (M2I98_32275) | 40376..41722 | + | 1347 | WP_045666092.1 | replicative DNA helicase | - |
| M2I98_RS32340 (M2I98_32280) | 41722..42201 | + | 480 | WP_045666093.1 | hypothetical protein | - |
| M2I98_RS32345 (M2I98_32285) | 42441..42902 | + | 462 | WP_045666094.1 | hypothetical protein | - |
| M2I98_RS32350 (M2I98_32290) | 42920..43162 | + | 243 | WP_202877142.1 | hypothetical protein | - |
| M2I98_RS32355 (M2I98_32295) | 43303..43638 | - | 336 | WP_042923308.1 | hypothetical protein | - |
| M2I98_RS32360 (M2I98_32300) | 43663..43944 | - | 282 | WP_023100672.1 | type II toxin-antitoxin system YafQ family toxin | - |
| M2I98_RS32365 (M2I98_32305) | 43931..44194 | - | 264 | WP_045666135.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| M2I98_RS32370 (M2I98_32310) | 44425..44769 | - | 345 | WP_045666095.1 | hypothetical protein | - |
| M2I98_RS32375 (M2I98_32315) | 44792..45151 | - | 360 | WP_045666096.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2I98_RS32380 (M2I98_32320) | 45148..45396 | - | 249 | WP_045666097.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M2I98_RS32385 (M2I98_32325) | 45393..45737 | - | 345 | WP_134277040.1 | hypothetical protein | - |
| M2I98_RS32390 (M2I98_32330) | 45893..46369 | - | 477 | WP_045666099.1 | single-stranded DNA-binding protein | - |
| M2I98_RS32395 (M2I98_32335) | 46380..46817 | - | 438 | WP_045666100.1 | hypothetical protein | - |
| M2I98_RS32400 (M2I98_32340) | 46826..47509 | - | 684 | WP_270036730.1 | adenylosuccinate synthase | - |
| M2I98_RS32405 (M2I98_32345) | 47506..48042 | - | 537 | WP_045666102.1 | hypothetical protein | - |
| M2I98_RS32410 (M2I98_32350) | 48039..48269 | - | 231 | WP_045666103.1 | hypothetical protein | - |
| M2I98_RS32415 (M2I98_32355) | 48259..50334 | - | 2076 | WP_270036727.1 | DNA cytosine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..113722 | 113722 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12459.51 Da Isoelectric Point: 10.2252
>T244274 WP_045666096.1 NZ_CP096959:c45151-44792 [Pseudomonas aeruginosa]
MTKRLQHQFDRGDIVSLDMGSALAHAPCKALVLSPAAYNALGLALAVPITEHDSARYAGFAVTILVPGRTPASGAALINL
VRPVDLAARHAKLLGHASPGTISDALLRLQTILGKQFTN
MTKRLQHQFDRGDIVSLDMGSALAHAPCKALVLSPAAYNALGLALAVPITEHDSARYAGFAVTILVPGRTPASGAALINL
VRPVDLAARHAKLLGHASPGTISDALLRLQTILGKQFTN
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|