244273

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 43663..44194 Replicon plasmid pNY11210-NR
Accession NZ_CP096959
Organism Pseudomonas aeruginosa strain NY11210

Toxin (Protein)


Gene name relE Uniprot ID A0A2K4Y311
Locus tag M2I98_RS32360 Protein ID WP_023100672.1
Coordinates 43663..43944 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag M2I98_RS32365 Protein ID WP_045666135.1
Coordinates 43931..44194 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2I98_RS32325 (M2I98_32265) 39218..39535 + 318 WP_191992243.1 hypothetical protein -
M2I98_RS32330 (M2I98_32270) 39692..40189 + 498 WP_238331510.1 hypothetical protein -
M2I98_RS32335 (M2I98_32275) 40376..41722 + 1347 WP_045666092.1 replicative DNA helicase -
M2I98_RS32340 (M2I98_32280) 41722..42201 + 480 WP_045666093.1 hypothetical protein -
M2I98_RS32345 (M2I98_32285) 42441..42902 + 462 WP_045666094.1 hypothetical protein -
M2I98_RS32350 (M2I98_32290) 42920..43162 + 243 WP_202877142.1 hypothetical protein -
M2I98_RS32355 (M2I98_32295) 43303..43638 - 336 WP_042923308.1 hypothetical protein -
M2I98_RS32360 (M2I98_32300) 43663..43944 - 282 WP_023100672.1 type II toxin-antitoxin system YafQ family toxin Toxin
M2I98_RS32365 (M2I98_32305) 43931..44194 - 264 WP_045666135.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
M2I98_RS32370 (M2I98_32310) 44425..44769 - 345 WP_045666095.1 hypothetical protein -
M2I98_RS32375 (M2I98_32315) 44792..45151 - 360 WP_045666096.1 type II toxin-antitoxin system PemK/MazF family toxin -
M2I98_RS32380 (M2I98_32320) 45148..45396 - 249 WP_045666097.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M2I98_RS32385 (M2I98_32325) 45393..45737 - 345 WP_134277040.1 hypothetical protein -
M2I98_RS32390 (M2I98_32330) 45893..46369 - 477 WP_045666099.1 single-stranded DNA-binding protein -
M2I98_RS32395 (M2I98_32335) 46380..46817 - 438 WP_045666100.1 hypothetical protein -
M2I98_RS32400 (M2I98_32340) 46826..47509 - 684 WP_270036730.1 adenylosuccinate synthase -
M2I98_RS32405 (M2I98_32345) 47506..48042 - 537 WP_045666102.1 hypothetical protein -
M2I98_RS32410 (M2I98_32350) 48039..48269 - 231 WP_045666103.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..113722 113722


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-84)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10724.19 Da        Isoelectric Point: 9.0277

>T244273 WP_023100672.1 NZ_CP096959:c43944-43663 [Pseudomonas aeruginosa]
MRTIEQTSRFKRDYKREAKGPHRQTLASDFVAIVTALANDQPLAEKHRDHALNGDWKDHRDCHIKPDLVLIYRKPDDAVL
QLVRLGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9473.92 Da        Isoelectric Point: 4.8096

>AT244273 WP_045666135.1 NZ_CP096959:c44194-43931 [Pseudomonas aeruginosa]
MSANAVVRARIDEHIKEEATAVLAAMGLTVSDAFRIMLTRVAREKALPFEPLIPNATTIEAMKEARRGGLKSFTSVEDLM
ADLNADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4Y311

Antitoxin

Source ID Structure

References