Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 217169..217716 Replicon plasmid pNY11173-DIM
Accession NZ_CP096957
Organism Pseudomonas aeruginosa strain NY11173

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag M2I96_RS31715 Protein ID WP_009873354.1
Coordinates 217390..217716 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag M2I96_RS31710 Protein ID WP_043149934.1
Coordinates 217169..217393 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2I96_RS31695 (M2I96_31610) 213014..213574 + 561 WP_015648284.1 recombinase family protein -
M2I96_RS31700 (M2I96_31615) 213578..216544 + 2967 WP_027590725.1 Tn3-like element TnAs1 family transposase -
M2I96_RS31705 (M2I96_31620) 216617..217102 + 486 WP_234285037.1 hypothetical protein -
M2I96_RS31710 (M2I96_31625) 217169..217393 + 225 WP_043149934.1 antitoxin MazE family protein Antitoxin
M2I96_RS31715 (M2I96_31630) 217390..217716 + 327 WP_009873354.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2I96_RS31720 (M2I96_31635) 217713..218039 + 327 WP_009873353.1 hypothetical protein -
M2I96_RS31725 (M2I96_31640) 218068..218946 + 879 WP_009873352.1 helicase RepA family protein -
M2I96_RS31730 (M2I96_31645) 218927..219919 + 993 WP_009873351.1 replication protein C, IncQ-type -
M2I96_RS31735 (M2I96_31650) 220136..220972 - 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
M2I96_RS31740 (M2I96_31655) 220972..221775 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
M2I96_RS31745 (M2I96_31660) 221841..222455 - 615 WP_000904906.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(3'')-Ia / blaOXA-4 / catB3 / dfrB3 / blaDIM-1 / aph(6)-Id / aph(3'')-Ib / aac(6')-IIa / qacE / floR / sul1 / dfrA1 / qnrVC6 - 1..412305 412305
- inside IScluster/Tn ant(3'')-Ia / blaOXA-4 / catB3 / dfrB3 / blaDIM-1 / aph(6)-Id / aph(3'')-Ib - 206425..222455 16030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-103)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11487.49 Da        Isoelectric Point: 9.2954

>T244267 WP_009873354.1 NZ_CP096957:217390-217716 [Pseudomonas aeruginosa]
MMRGDLVTIAMQGDFGKPRPALVVQANQFSEHGSVTVLPVTSTLNAAPLLRVTVQPSAENGLQKPSQVMVDKAMTVLRSK
VGPAFGRIDADALLEVERCLAVFLGIAK

Download         Length: 327 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8468.56 Da        Isoelectric Point: 5.0038

>AT244267 WP_043149934.1 NZ_CP096957:217169-217393 [Pseudomonas aeruginosa]
MATAHVNQRVQKHRDALRMAGLRPVQIWVPDTRRPDFAEECRRQCLLVAQADSADTAMQQFMDEALADVDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References