Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 217169..217716 | Replicon | plasmid pNY11173-DIM |
Accession | NZ_CP096957 | ||
Organism | Pseudomonas aeruginosa strain NY11173 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M2I96_RS31715 | Protein ID | WP_009873354.1 |
Coordinates | 217390..217716 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M2I96_RS31710 | Protein ID | WP_043149934.1 |
Coordinates | 217169..217393 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I96_RS31695 (M2I96_31610) | 213014..213574 | + | 561 | WP_015648284.1 | recombinase family protein | - |
M2I96_RS31700 (M2I96_31615) | 213578..216544 | + | 2967 | WP_027590725.1 | Tn3-like element TnAs1 family transposase | - |
M2I96_RS31705 (M2I96_31620) | 216617..217102 | + | 486 | WP_234285037.1 | hypothetical protein | - |
M2I96_RS31710 (M2I96_31625) | 217169..217393 | + | 225 | WP_043149934.1 | antitoxin MazE family protein | Antitoxin |
M2I96_RS31715 (M2I96_31630) | 217390..217716 | + | 327 | WP_009873354.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2I96_RS31720 (M2I96_31635) | 217713..218039 | + | 327 | WP_009873353.1 | hypothetical protein | - |
M2I96_RS31725 (M2I96_31640) | 218068..218946 | + | 879 | WP_009873352.1 | helicase RepA family protein | - |
M2I96_RS31730 (M2I96_31645) | 218927..219919 | + | 993 | WP_009873351.1 | replication protein C, IncQ-type | - |
M2I96_RS31735 (M2I96_31650) | 220136..220972 | - | 837 | WP_000480968.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
M2I96_RS31740 (M2I96_31655) | 220972..221775 | - | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
M2I96_RS31745 (M2I96_31660) | 221841..222455 | - | 615 | WP_000904906.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | ant(3'')-Ia / blaOXA-4 / catB3 / dfrB3 / blaDIM-1 / aph(6)-Id / aph(3'')-Ib / aac(6')-IIa / qacE / floR / sul1 / dfrA1 / qnrVC6 | - | 1..412305 | 412305 | |
- | inside | IScluster/Tn | ant(3'')-Ia / blaOXA-4 / catB3 / dfrB3 / blaDIM-1 / aph(6)-Id / aph(3'')-Ib | - | 206425..222455 | 16030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11487.49 Da Isoelectric Point: 9.2954
>T244267 WP_009873354.1 NZ_CP096957:217390-217716 [Pseudomonas aeruginosa]
MMRGDLVTIAMQGDFGKPRPALVVQANQFSEHGSVTVLPVTSTLNAAPLLRVTVQPSAENGLQKPSQVMVDKAMTVLRSK
VGPAFGRIDADALLEVERCLAVFLGIAK
MMRGDLVTIAMQGDFGKPRPALVVQANQFSEHGSVTVLPVTSTLNAAPLLRVTVQPSAENGLQKPSQVMVDKAMTVLRSK
VGPAFGRIDADALLEVERCLAVFLGIAK
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|