Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 4921744..4922352 | Replicon | chromosome |
Accession | NZ_CP096956 | ||
Organism | Pseudomonas aeruginosa strain NY11173 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | M2I96_RS23005 | Protein ID | WP_016263850.1 |
Coordinates | 4921744..4922091 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | M2I96_RS23010 | Protein ID | WP_003114155.1 |
Coordinates | 4922101..4922352 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I96_RS22975 (M2I96_22905) | 4917163..4917375 | + | 213 | WP_003098360.1 | cysteine-rich CWC family protein | - |
M2I96_RS22980 (M2I96_22910) | 4917375..4918067 | + | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
M2I96_RS22985 (M2I96_22915) | 4918203..4919246 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
M2I96_RS22990 (M2I96_22920) | 4919326..4920063 | + | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
M2I96_RS22995 (M2I96_22925) | 4920515..4921417 | + | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
M2I96_RS23005 (M2I96_22935) | 4921744..4922091 | - | 348 | WP_016263850.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I96_RS23010 (M2I96_22940) | 4922101..4922352 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M2I96_RS23015 (M2I96_22945) | 4922566..4923549 | - | 984 | WP_019725833.1 | tyrosine-type recombinase/integrase | - |
M2I96_RS23020 (M2I96_22950) | 4923549..4924841 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
M2I96_RS23025 (M2I96_22955) | 4925100..4926362 | - | 1263 | WP_019725831.1 | zonular occludens toxin domain-containing protein | - |
M2I96_RS23030 (M2I96_22960) | 4926364..4926714 | - | 351 | WP_019725830.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 4921744..4943887 | 22143 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13046.85 Da Isoelectric Point: 4.4212
>T244264 WP_016263850.1 NZ_CP096956:c4922091-4921744 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLVPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|