Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 148277..148782 | Replicon | chromosome |
Accession | NZ_CP096956 | ||
Organism | Pseudomonas aeruginosa strain NY11173 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | M2I96_RS00665 | Protein ID | WP_003083773.1 |
Coordinates | 148277..148558 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | M2I96_RS00670 | Protein ID | WP_003083775.1 |
Coordinates | 148555..148782 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I96_RS00640 (M2I96_00640) | 143528..144877 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
M2I96_RS00645 (M2I96_00645) | 144926..145612 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
M2I96_RS00650 (M2I96_00650) | 145713..146447 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
M2I96_RS00655 (M2I96_00655) | 146627..147037 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
M2I96_RS00660 (M2I96_00660) | 147069..147977 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
M2I96_RS00665 (M2I96_00665) | 148277..148558 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
M2I96_RS00670 (M2I96_00670) | 148555..148782 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
M2I96_RS00675 (M2I96_00675) | 148958..149578 | - | 621 | WP_009314940.1 | hypothetical protein | - |
M2I96_RS00680 (M2I96_00680) | 149679..150179 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
M2I96_RS00685 (M2I96_00685) | 150252..150593 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
M2I96_RS00690 (M2I96_00690) | 150675..152102 | - | 1428 | WP_003083784.1 | GABA permease | - |
M2I96_RS00695 (M2I96_00695) | 152271..153764 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244259 WP_003083773.1 NZ_CP096956:c148558-148277 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|