Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 179323..179828 | Replicon | chromosome |
| Accession | NZ_CP096953 | ||
| Organism | Pseudomonas aeruginosa strain NY5535 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | M2I95_RS00805 | Protein ID | WP_003083773.1 |
| Coordinates | 179323..179604 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | M2I95_RS00810 | Protein ID | WP_003083775.1 |
| Coordinates | 179601..179828 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I95_RS00780 (M2I95_00780) | 174574..175923 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
| M2I95_RS00785 (M2I95_00785) | 175972..176658 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| M2I95_RS00790 (M2I95_00790) | 176759..177493 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| M2I95_RS00795 (M2I95_00795) | 177673..178083 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| M2I95_RS00800 (M2I95_00800) | 178115..179023 | - | 909 | WP_023132709.1 | LysR family transcriptional regulator | - |
| M2I95_RS00805 (M2I95_00805) | 179323..179604 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| M2I95_RS00810 (M2I95_00810) | 179601..179828 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M2I95_RS00815 (M2I95_00815) | 180004..180624 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| M2I95_RS00820 (M2I95_00820) | 180725..181225 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| M2I95_RS00825 (M2I95_00825) | 181298..181639 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| M2I95_RS00830 (M2I95_00830) | 181721..183148 | - | 1428 | WP_003083784.1 | GABA permease | - |
| M2I95_RS00835 (M2I95_00835) | 183317..184810 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244254 WP_003083773.1 NZ_CP096953:c179604-179323 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|