Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5531951..5532537 | Replicon | chromosome |
Accession | NZ_CP096950 | ||
Organism | Pseudomonas aeruginosa strain NY5532 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | M2I94_RS26150 | Protein ID | WP_003120987.1 |
Coordinates | 5532238..5532537 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M2I94_RS26145 | Protein ID | WP_003448662.1 |
Coordinates | 5531951..5532241 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I94_RS26130 (M2I94_26040) | 5527527..5529422 | + | 1896 | WP_267671723.1 | hypothetical protein | - |
M2I94_RS26135 (M2I94_26045) | 5529419..5531395 | + | 1977 | WP_128666225.1 | DEAD/DEAH box helicase | - |
M2I94_RS26140 (M2I94_26050) | 5531536..5531880 | + | 345 | WP_003448665.1 | hypothetical protein | - |
M2I94_RS26145 (M2I94_26055) | 5531951..5532241 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
M2I94_RS26150 (M2I94_26060) | 5532238..5532537 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I94_RS26155 (M2I94_26065) | 5532739..5533425 | + | 687 | WP_283859371.1 | PilL N-terminal domain-containing protein | - |
M2I94_RS26160 (M2I94_26070) | 5533436..5533864 | + | 429 | WP_283859372.1 | toxin co-regulated pilus biosynthesis Q family protein | - |
M2I94_RS26165 (M2I94_26075) | 5533864..5535573 | + | 1710 | WP_283859373.1 | PilN family type IVB pilus formation outer membrane protein | - |
M2I94_RS26170 (M2I94_26080) | 5535577..5536902 | + | 1326 | WP_003149518.1 | type 4b pilus protein PilO2 | - |
M2I94_RS26175 (M2I94_26085) | 5536892..5537425 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5500526..5587779 | 87253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T244250 WP_003120987.1 NZ_CP096950:c5532537-5532238 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|