Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2555094..2555610 | Replicon | chromosome |
| Accession | NZ_CP096950 | ||
| Organism | Pseudomonas aeruginosa strain NY5532 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | M2I94_RS12420 | Protein ID | WP_025297453.1 |
| Coordinates | 2555329..2555610 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | M2I94_RS12415 | Protein ID | WP_025297454.1 |
| Coordinates | 2555094..2555339 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I94_RS12400 (M2I94_12365) | 2551933..2552964 | - | 1032 | WP_283859411.1 | WYL domain-containing protein | - |
| M2I94_RS12405 (M2I94_12370) | 2553003..2554165 | + | 1163 | WP_176704564.1 | IS3 family transposase | - |
| M2I94_RS12410 (M2I94_12375) | 2554405..2554659 | - | 255 | WP_153574174.1 | hypothetical protein | - |
| M2I94_RS12415 (M2I94_12380) | 2555094..2555339 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| M2I94_RS12420 (M2I94_12385) | 2555329..2555610 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I94_RS12425 (M2I94_12390) | 2556016..2556597 | - | 582 | WP_033976848.1 | plasmid pRiA4b ORF-3 family protein | - |
| M2I94_RS12430 (M2I94_12395) | 2556611..2557486 | - | 876 | WP_033976847.1 | WYL domain-containing protein | - |
| M2I94_RS12435 (M2I94_12400) | 2557616..2559196 | + | 1581 | WP_070147860.1 | DNA recombination protein RmuC | - |
| M2I94_RS12440 (M2I94_12405) | 2559220..2559867 | + | 648 | WP_033976844.1 | peptidase M15 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2542296..2586779 | 44483 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T244247 WP_025297453.1 NZ_CP096950:2555329-2555610 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |