Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5137819..5138427 | Replicon | chromosome |
Accession | NZ_CP096945 | ||
Organism | Pseudomonas aeruginosa strain NY5525 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | M2I92_RS24785 | Protein ID | WP_003123043.1 |
Coordinates | 5137819..5138166 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | M2I92_RS24790 | Protein ID | WP_003114155.1 |
Coordinates | 5138176..5138427 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I92_RS24755 (M2I92_24675) | 5133238..5133450 | + | 213 | WP_015503462.1 | cysteine-rich CWC family protein | - |
M2I92_RS24760 (M2I92_24680) | 5133450..5134142 | + | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
M2I92_RS24765 (M2I92_24685) | 5134278..5135321 | + | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
M2I92_RS24770 (M2I92_24690) | 5135401..5136138 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
M2I92_RS24775 (M2I92_24695) | 5136590..5137492 | + | 903 | WP_003163340.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
M2I92_RS24785 (M2I92_24705) | 5137819..5138166 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I92_RS24790 (M2I92_24710) | 5138176..5138427 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M2I92_RS24795 (M2I92_24715) | 5138641..5139624 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
M2I92_RS24800 (M2I92_24720) | 5139624..5140916 | - | 1293 | WP_003123045.1 | hypothetical protein | - |
M2I92_RS24805 (M2I92_24725) | 5141146..5142420 | - | 1275 | WP_003151267.1 | zonular occludens toxin family protein | - |
M2I92_RS24810 (M2I92_24730) | 5142424..5142780 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5137819..5158413 | 20594 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T244237 WP_003123043.1 NZ_CP096945:c5138166-5137819 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |