Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4784840..4785426 | Replicon | chromosome |
| Accession | NZ_CP096945 | ||
| Organism | Pseudomonas aeruginosa strain NY5525 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | M2I92_RS22985 | Protein ID | WP_003120987.1 |
| Coordinates | 4785127..4785426 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | M2I92_RS22980 | Protein ID | WP_003448662.1 |
| Coordinates | 4784840..4785130 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I92_RS22960 (M2I92_22890) | 4780416..4782311 | + | 1896 | WP_234493604.1 | hypothetical protein | - |
| M2I92_RS22965 (M2I92_22895) | 4782308..4784284 | + | 1977 | WP_042931628.1 | DEAD/DEAH box helicase | - |
| M2I92_RS22970 | 4784294..4784428 | + | 135 | WP_033179080.1 | hypothetical protein | - |
| M2I92_RS22975 (M2I92_22900) | 4784425..4784769 | + | 345 | WP_003448665.1 | hypothetical protein | - |
| M2I92_RS22980 (M2I92_22905) | 4784840..4785130 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| M2I92_RS22985 (M2I92_22910) | 4785127..4785426 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I92_RS22990 (M2I92_22915) | 4785628..4786749 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
| M2I92_RS22995 (M2I92_22920) | 4786749..4788458 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
| M2I92_RS23000 (M2I92_22925) | 4788462..4789787 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| M2I92_RS23005 (M2I92_22930) | 4789777..4790310 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4756231..4840431 | 84200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T244236 WP_003120987.1 NZ_CP096945:c4785426-4785127 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|