Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5884767..5885353 | Replicon | chromosome |
Accession | NZ_CP096942 | ||
Organism | Pseudomonas aeruginosa strain NY5524 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | M2I87_RS28395 | Protein ID | WP_003120987.1 |
Coordinates | 5885054..5885353 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | M2I87_RS28390 | Protein ID | WP_003448662.1 |
Coordinates | 5884767..5885057 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I87_RS28370 (M2I87_28245) | 5880343..5882238 | + | 1896 | WP_234493604.1 | hypothetical protein | - |
M2I87_RS28375 (M2I87_28250) | 5882235..5884211 | + | 1977 | WP_042931628.1 | DEAD/DEAH box helicase | - |
M2I87_RS28380 | 5884221..5884355 | + | 135 | WP_033179080.1 | hypothetical protein | - |
M2I87_RS28385 (M2I87_28255) | 5884352..5884696 | + | 345 | WP_003448665.1 | hypothetical protein | - |
M2I87_RS28390 (M2I87_28260) | 5884767..5885057 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
M2I87_RS28395 (M2I87_28265) | 5885054..5885353 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I87_RS28400 (M2I87_28270) | 5885555..5886676 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
M2I87_RS28405 (M2I87_28275) | 5886676..5888385 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
M2I87_RS28410 (M2I87_28280) | 5888389..5889714 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
M2I87_RS28415 (M2I87_28285) | 5889704..5890237 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5853526..5942128 | 88602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T244230 WP_003120987.1 NZ_CP096942:c5885353-5885054 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|