Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 3640642..3641158 | Replicon | chromosome |
Accession | NZ_CP096942 | ||
Organism | Pseudomonas aeruginosa strain NY5524 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3R8UIH5 |
Locus tag | M2I87_RS17215 | Protein ID | WP_025297453.1 |
Coordinates | 3640642..3640923 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | M2I87_RS17220 | Protein ID | WP_025297454.1 |
Coordinates | 3640913..3641158 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I87_RS17195 (M2I87_17105) | 3636385..3637032 | - | 648 | WP_033976844.1 | peptidase M15 | - |
M2I87_RS17200 (M2I87_17110) | 3637056..3638636 | - | 1581 | WP_070147860.1 | DNA recombination protein RmuC | - |
M2I87_RS17205 (M2I87_17115) | 3638766..3639641 | + | 876 | WP_033976847.1 | WYL domain-containing protein | - |
M2I87_RS17210 (M2I87_17120) | 3639655..3640236 | + | 582 | WP_033976848.1 | plasmid pRiA4b ORF-3 family protein | - |
M2I87_RS17215 (M2I87_17125) | 3640642..3640923 | - | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I87_RS17220 (M2I87_17130) | 3640913..3641158 | - | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M2I87_RS17225 (M2I87_17135) | 3641593..3641847 | + | 255 | WP_153574174.1 | hypothetical protein | - |
M2I87_RS17230 (M2I87_17140) | 3642005..3643081 | + | 1077 | WP_052156709.1 | WYL domain-containing protein | - |
M2I87_RS17235 (M2I87_17145) | 3643179..3645380 | + | 2202 | WP_033976850.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3609163..3656448 | 47285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T244227 WP_025297453.1 NZ_CP096942:c3640923-3640642 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8UIM7 |