Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 196690..197195 | Replicon | chromosome |
| Accession | NZ_CP096942 | ||
| Organism | Pseudomonas aeruginosa strain NY5524 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | M2I87_RS00935 | Protein ID | WP_003083773.1 |
| Coordinates | 196690..196971 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | M2I87_RS00940 | Protein ID | WP_003083775.1 |
| Coordinates | 196968..197195 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I87_RS00910 (M2I87_00905) | 191941..193290 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| M2I87_RS00915 (M2I87_00910) | 193339..194025 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| M2I87_RS00920 (M2I87_00915) | 194126..194860 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| M2I87_RS00925 (M2I87_00920) | 195040..195450 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| M2I87_RS00930 (M2I87_00925) | 195482..196390 | - | 909 | WP_010793581.1 | LysR family transcriptional regulator | - |
| M2I87_RS00935 (M2I87_00930) | 196690..196971 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| M2I87_RS00940 (M2I87_00935) | 196968..197195 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M2I87_RS00945 (M2I87_00940) | 197371..197991 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| M2I87_RS00950 (M2I87_00945) | 198092..198592 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| M2I87_RS00955 (M2I87_00950) | 198665..199006 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| M2I87_RS00960 (M2I87_00955) | 199088..200515 | - | 1428 | WP_003083784.1 | GABA permease | - |
| M2I87_RS00965 (M2I87_00960) | 200684..202177 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T244223 WP_003083773.1 NZ_CP096942:c196971-196690 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|