Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 4213551..4214593 | Replicon | chromosome |
| Accession | NZ_CP096941 | ||
| Organism | Pseudomonas aeruginosa strain NY5523 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | M2I88_RS19595 | Protein ID | WP_003153636.1 |
| Coordinates | 4213551..4214126 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | M2I88_RS19600 | Protein ID | WP_003050245.1 |
| Coordinates | 4214123..4214593 (-) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I88_RS19570 (M2I88_19515) | 4209989..4210714 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
| M2I88_RS19575 (M2I88_19520) | 4210753..4211655 | - | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
| M2I88_RS19580 (M2I88_19525) | 4211655..4212155 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| M2I88_RS19585 (M2I88_19530) | 4212152..4212622 | - | 471 | WP_063305693.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| M2I88_RS19590 (M2I88_19535) | 4212619..4213533 | - | 915 | WP_016852809.1 | AAA family ATPase | - |
| M2I88_RS19595 (M2I88_19540) | 4213551..4214126 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| M2I88_RS19600 (M2I88_19545) | 4214123..4214593 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M2I88_RS19605 (M2I88_19550) | 4214797..4215180 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| M2I88_RS19610 (M2I88_19555) | 4215177..4215410 | + | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
| M2I88_RS19615 (M2I88_19560) | 4215427..4215786 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| M2I88_RS19620 (M2I88_19565) | 4215798..4216196 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
| M2I88_RS19625 (M2I88_19570) | 4216193..4216885 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
| M2I88_RS19630 (M2I88_19575) | 4216882..4217793 | + | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
| M2I88_RS19635 (M2I88_19580) | 4217783..4219201 | + | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 4165155..4289168 | 124013 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T244220 WP_003153636.1 NZ_CP096941:c4214126-4213551 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT244220 WP_003050245.1 NZ_CP096941:c4214593-4214123 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|