Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 28263..28956 | Replicon | plasmid pNY5520-KPC |
Accession | NZ_CP096939 | ||
Organism | Pseudomonas aeruginosa strain NY5520 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | M2I89_RS31320 | Protein ID | WP_252049631.1 |
Coordinates | 28579..28956 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | M2I89_RS31315 | Protein ID | WP_001172026.1 |
Coordinates | 28263..28598 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I89_RS31285 (M2I89_31220) | 25191..25601 | + | 411 | Protein_27 | IS5-like element IS5B family transposase | - |
M2I89_RS31290 (M2I89_31225) | 25768..26637 | - | 870 | WP_223198360.1 | HD-GYP domain-containing protein | - |
M2I89_RS31295 (M2I89_31230) | 26721..27029 | - | 309 | WP_283903194.1 | DUF3391 domain-containing protein | - |
M2I89_RS31300 (M2I89_31235) | 27186..27566 | - | 381 | Protein_30 | hypothetical protein | - |
M2I89_RS31305 (M2I89_31240) | 27563..27889 | - | 327 | WP_000091614.1 | hypothetical protein | - |
M2I89_RS31310 (M2I89_31245) | 27913..28248 | - | 336 | WP_000741275.1 | hypothetical protein | - |
M2I89_RS31315 (M2I89_31250) | 28263..28598 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M2I89_RS31320 (M2I89_31255) | 28579..28956 | - | 378 | WP_252049631.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I89_RS31325 (M2I89_31260) | 29148..29750 | + | 603 | WP_010465829.1 | recombinase family protein | - |
M2I89_RS31330 (M2I89_31265) | 29734..31110 | + | 1377 | Protein_36 | DUF4158 domain-containing protein | - |
M2I89_RS31335 (M2I89_31270) | 31148..31282 | + | 135 | Protein_37 | transposase DNA-binding-containing protein | - |
M2I89_RS31340 (M2I89_31275) | 31537..32175 | + | 639 | WP_008166580.1 | ParA family partition ATPase | - |
M2I89_RS31345 (M2I89_31280) | 32197..32418 | + | 222 | WP_226453204.1 | plasmid partition protein ParG | - |
M2I89_RS31350 (M2I89_31285) | 32452..32838 | + | 387 | WP_011270177.1 | ParC family partition-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 | - | 1..33003 | 33003 | |
- | inside | IScluster/Tn | blaKPC-2 | - | 13416..31134 | 17718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13735.76 Da Isoelectric Point: 8.9046
>T244216 WP_252049631.1 NZ_CP096939:c28956-28579 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|