Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tad-ata/COG5606-COG4679
Location 28263..28956 Replicon plasmid pNY5520-KPC
Accession NZ_CP096939
Organism Pseudomonas aeruginosa strain NY5520

Toxin (Protein)


Gene name tad Uniprot ID -
Locus tag M2I89_RS31320 Protein ID WP_252049631.1
Coordinates 28579..28956 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name ata Uniprot ID N2IIN5
Locus tag M2I89_RS31315 Protein ID WP_001172026.1
Coordinates 28263..28598 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2I89_RS31285 (M2I89_31220) 25191..25601 + 411 Protein_27 IS5-like element IS5B family transposase -
M2I89_RS31290 (M2I89_31225) 25768..26637 - 870 WP_223198360.1 HD-GYP domain-containing protein -
M2I89_RS31295 (M2I89_31230) 26721..27029 - 309 WP_283903194.1 DUF3391 domain-containing protein -
M2I89_RS31300 (M2I89_31235) 27186..27566 - 381 Protein_30 hypothetical protein -
M2I89_RS31305 (M2I89_31240) 27563..27889 - 327 WP_000091614.1 hypothetical protein -
M2I89_RS31310 (M2I89_31245) 27913..28248 - 336 WP_000741275.1 hypothetical protein -
M2I89_RS31315 (M2I89_31250) 28263..28598 - 336 WP_001172026.1 helix-turn-helix transcriptional regulator Antitoxin
M2I89_RS31320 (M2I89_31255) 28579..28956 - 378 WP_252049631.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M2I89_RS31325 (M2I89_31260) 29148..29750 + 603 WP_010465829.1 recombinase family protein -
M2I89_RS31330 (M2I89_31265) 29734..31110 + 1377 Protein_36 DUF4158 domain-containing protein -
M2I89_RS31335 (M2I89_31270) 31148..31282 + 135 Protein_37 transposase DNA-binding-containing protein -
M2I89_RS31340 (M2I89_31275) 31537..32175 + 639 WP_008166580.1 ParA family partition ATPase -
M2I89_RS31345 (M2I89_31280) 32197..32418 + 222 WP_226453204.1 plasmid partition protein ParG -
M2I89_RS31350 (M2I89_31285) 32452..32838 + 387 WP_011270177.1 ParC family partition-associated protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 - 1..33003 33003
- inside IScluster/Tn blaKPC-2 - 13416..31134 17718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-109)

Antitoxin

Cro/C1-type helix-turn-helix domain

(40-93)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13735.76 Da        Isoelectric Point: 8.9046

>T244216 WP_252049631.1 NZ_CP096939:c28956-28579 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH

Download         Length: 378 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12201.39 Da        Isoelectric Point: 10.6058

>AT244216 WP_001172026.1 NZ_CP096939:c28598-28263 [Pseudomonas aeruginosa]
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A024EKI7

References