Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5096057..5096643 | Replicon | chromosome |
| Accession | NZ_CP096927 | ||
| Organism | Pseudomonas aeruginosa strain NY5506 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | M2I82_RS23575 | Protein ID | WP_003120987.1 |
| Coordinates | 5096344..5096643 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | M2I82_RS23570 | Protein ID | WP_003448662.1 |
| Coordinates | 5096057..5096347 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2I82_RS23550 (M2I82_23495) | 5091633..5093528 | + | 1896 | WP_234493604.1 | hypothetical protein | - |
| M2I82_RS23555 (M2I82_23500) | 5093525..5095501 | + | 1977 | WP_270018599.1 | DEAD/DEAH box helicase | - |
| M2I82_RS23560 | 5095511..5095645 | + | 135 | WP_033179080.1 | hypothetical protein | - |
| M2I82_RS23565 (M2I82_23505) | 5095642..5095986 | + | 345 | WP_003448665.1 | hypothetical protein | - |
| M2I82_RS23570 (M2I82_23510) | 5096057..5096347 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| M2I82_RS23575 (M2I82_23515) | 5096344..5096643 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2I82_RS23580 (M2I82_23520) | 5096845..5097966 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
| M2I82_RS23585 (M2I82_23525) | 5097966..5099675 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
| M2I82_RS23590 (M2I82_23530) | 5099679..5101004 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| M2I82_RS23595 (M2I82_23535) | 5100994..5101527 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 5067718..5153598 | 85880 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T244193 WP_003120987.1 NZ_CP096927:c5096643-5096344 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|