Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2419129..2419645 | Replicon | chromosome |
Accession | NZ_CP096927 | ||
Organism | Pseudomonas aeruginosa strain NY5506 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M2I82_RS11480 | Protein ID | WP_224154839.1 |
Coordinates | 2419364..2419645 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A3R8UIM7 |
Locus tag | M2I82_RS11475 | Protein ID | WP_025297454.1 |
Coordinates | 2419129..2419374 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2I82_RS11455 (M2I82_11435) | 2414248..2414580 | - | 333 | WP_071536798.1 | hypothetical protein | - |
M2I82_RS11460 (M2I82_11440) | 2414928..2415596 | + | 669 | WP_071536799.1 | hypothetical protein | - |
M2I82_RS11465 (M2I82_11445) | 2415593..2416699 | + | 1107 | WP_043106099.1 | XRE family transcriptional regulator | - |
M2I82_RS11470 (M2I82_11450) | 2416842..2418971 | + | 2130 | WP_224154841.1 | NERD domain-containing protein | - |
M2I82_RS11475 (M2I82_11455) | 2419129..2419374 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M2I82_RS11480 (M2I82_11460) | 2419364..2419645 | + | 282 | WP_224154839.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2I82_RS11485 (M2I82_11465) | 2420054..2420635 | - | 582 | WP_224154837.1 | plasmid pRiA4b ORF-3 family protein | - |
M2I82_RS11490 (M2I82_11470) | 2420649..2421524 | - | 876 | WP_043107117.1 | WYL domain-containing protein | - |
M2I82_RS11495 (M2I82_11475) | 2421653..2423233 | + | 1581 | WP_063837559.1 | DNA recombination protein RmuC | - |
M2I82_RS11500 (M2I82_11480) | 2423257..2423904 | + | 648 | WP_043106453.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10834.65 Da Isoelectric Point: 10.6249
>T244190 WP_224154839.1 NZ_CP096927:2419364-2419645 [Pseudomonas aeruginosa]
MTYELELLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRTSGYRLVYRVEDERLVVVVVAVGK
RERGAAYQSAKGR
MTYELELLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRTSGYRLVYRVEDERLVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|