Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 2340124..2340740 | Replicon | chromosome |
| Accession | NZ_CP096923 | ||
| Organism | Enterobacter hormaechei strain NY0401 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M2M22_RS11150 | Protein ID | WP_080469998.1 |
| Coordinates | 2340124..2340495 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A9E7BIL4 |
| Locus tag | M2M22_RS11155 | Protein ID | WP_023298920.1 |
| Coordinates | 2340498..2340740 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2M22_RS11135 (M2M22_11130) | 2337624..2338526 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
| M2M22_RS11140 (M2M22_11135) | 2338523..2339158 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M2M22_RS11145 (M2M22_11140) | 2339155..2340084 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
| M2M22_RS11150 (M2M22_11145) | 2340124..2340495 | - | 372 | WP_080469998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M2M22_RS11155 (M2M22_11150) | 2340498..2340740 | - | 243 | WP_023298920.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| M2M22_RS11160 (M2M22_11155) | 2340940..2341860 | + | 921 | WP_063146850.1 | alpha/beta hydrolase | - |
| M2M22_RS11165 (M2M22_11160) | 2341869..2342810 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
| M2M22_RS11170 (M2M22_11165) | 2342855..2343292 | - | 438 | WP_063146849.1 | D-aminoacyl-tRNA deacylase | - |
| M2M22_RS11175 (M2M22_11170) | 2343289..2344170 | - | 882 | WP_023298923.1 | virulence factor BrkB family protein | - |
| M2M22_RS11180 (M2M22_11175) | 2344164..2344763 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
| M2M22_RS11185 (M2M22_11180) | 2344882..2345682 | - | 801 | WP_023298924.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2330347..2341860 | 11513 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13624.68 Da Isoelectric Point: 6.4866
>T244186 WP_080469998.1 NZ_CP096923:c2340495-2340124 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNHVEAADAIDRTASHRAISLITWMEVMVGARRHGQEARTAAVMGAFEIIDITREIAERSVLLR
EQHGMKLPDAIILATAQSRSCPLISRNTKDFSGIAGVVSPYHL
MEHMAVFDTNILIDLFNNHVEAADAIDRTASHRAISLITWMEVMVGARRHGQEARTAAVMGAFEIIDITREIAERSVLLR
EQHGMKLPDAIILATAQSRSCPLISRNTKDFSGIAGVVSPYHL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|