Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2217977..2218584 | Replicon | chromosome |
Accession | NZ_CP096923 | ||
Organism | Enterobacter hormaechei strain NY0401 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A2J0PXG2 |
Locus tag | M2M22_RS10600 | Protein ID | WP_071788668.1 |
Coordinates | 2218399..2218584 (-) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | M2M22_RS10595 | Protein ID | WP_063147030.1 |
Coordinates | 2217977..2218384 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2M22_RS10565 (M2M22_10560) | 2213818..2214471 | + | 654 | WP_023298862.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
M2M22_RS10570 (M2M22_10565) | 2214474..2215334 | + | 861 | WP_023298863.1 | L-ribulose-5-phosphate 3-epimerase | - |
M2M22_RS10575 (M2M22_10570) | 2215328..2216023 | + | 696 | WP_038416909.1 | L-ribulose-5-phosphate 4-epimerase | - |
M2M22_RS10580 (M2M22_10575) | 2216024..2216314 | - | 291 | Protein_2074 | helix-turn-helix domain-containing protein | - |
M2M22_RS10585 (M2M22_10580) | 2216309..2216695 | + | 387 | Protein_2075 | glycoside hydrolase family 127 protein | - |
M2M22_RS10590 (M2M22_10585) | 2216897..2217973 | + | 1077 | WP_047354172.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
M2M22_RS10595 (M2M22_10590) | 2217977..2218384 | - | 408 | WP_063147030.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M2M22_RS10600 (M2M22_10595) | 2218399..2218584 | - | 186 | WP_071788668.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M2M22_RS10605 (M2M22_10600) | 2218828..2220366 | - | 1539 | WP_023307168.1 | aldehyde dehydrogenase AldB | - |
M2M22_RS10610 (M2M22_10605) | 2220533..2221417 | + | 885 | WP_270094182.1 | ROK family protein | - |
M2M22_RS10615 (M2M22_10610) | 2221421..2223259 | - | 1839 | WP_063842094.1 | selenocysteine-specific translation elongation factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6822.05 Da Isoelectric Point: 11.5191
>T244185 WP_071788668.1 NZ_CP096923:c2218584-2218399 [Enterobacter hormaechei]
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADIIAVLVSHGWKCVRTKGSHHQFRHPVQKGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 15146.93 Da Isoelectric Point: 4.4217
>AT244185 WP_063147030.1 NZ_CP096923:c2218384-2217977 [Enterobacter hormaechei]
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDAREALTAHFEALFEMDEALPLPGNVEVHLENHPDDFSGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
MFYPAYIHSDSDGSASGFFPDVPGCFFAGDSLDDAFQDAREALTAHFEALFEMDEALPLPGNVEVHLENHPDDFSGGQWL
LVDINMKQFDGRAERINITMPRRLLVKIDSFVSEHPQFGNRSAFLAEAARRVLPR
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|