Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1528132..1528789 | Replicon | chromosome |
| Accession | NZ_CP096923 | ||
| Organism | Enterobacter hormaechei strain NY0401 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | M2M22_RS07285 | Protein ID | WP_063146504.1 |
| Coordinates | 1528132..1528542 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | M2M22_RS07290 | Protein ID | WP_003863437.1 |
| Coordinates | 1528523..1528789 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2M22_RS07265 (M2M22_07260) | 1524130..1525863 | - | 1734 | WP_063146503.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M2M22_RS07270 (M2M22_07265) | 1525869..1526582 | - | 714 | WP_022649304.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M2M22_RS07275 (M2M22_07270) | 1526611..1527507 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| M2M22_RS07280 (M2M22_07275) | 1527609..1528130 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| M2M22_RS07285 (M2M22_07280) | 1528132..1528542 | - | 411 | WP_063146504.1 | protein YgfX | Toxin |
| M2M22_RS07290 (M2M22_07285) | 1528523..1528789 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| M2M22_RS07295 (M2M22_07290) | 1529084..1530064 | + | 981 | WP_063146505.1 | tRNA-modifying protein YgfZ | - |
| M2M22_RS07300 (M2M22_07295) | 1530586..1531245 | - | 660 | WP_022649307.1 | hemolysin III family protein | - |
| M2M22_RS07305 (M2M22_07300) | 1531512..1532243 | + | 732 | WP_063146842.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16312.19 Da Isoelectric Point: 11.4775
>T244184 WP_063146504.1 NZ_CP096923:c1528542-1528132 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQQLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQQLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|