Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 4010277..4011160 | Replicon | chromosome |
Accession | NZ_CP096920 | ||
Organism | Pseudomonas putida strain NY4811 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | M2J85_RS18840 | Protein ID | WP_060537713.1 |
Coordinates | 4010277..4010714 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | I7C3Q7 |
Locus tag | M2J85_RS18845 | Protein ID | WP_003250525.1 |
Coordinates | 4010711..4011160 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J85_RS18825 (M2J85_18745) | 4006578..4007807 | - | 1230 | WP_003250533.1 | acyl-CoA dehydrogenase | - |
M2J85_RS18830 (M2J85_18750) | 4007948..4008871 | + | 924 | WP_004573723.1 | LysR family transcriptional regulator | - |
M2J85_RS18835 (M2J85_18755) | 4009065..4010219 | + | 1155 | WP_060537721.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
M2J85_RS18840 (M2J85_18760) | 4010277..4010714 | - | 438 | WP_060537713.1 | RES family NAD+ phosphorylase | Toxin |
M2J85_RS18845 (M2J85_18765) | 4010711..4011160 | - | 450 | WP_003250525.1 | DUF2384 domain-containing protein | Antitoxin |
M2J85_RS18850 (M2J85_18770) | 4011303..4011956 | - | 654 | WP_004573726.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
M2J85_RS18855 (M2J85_18775) | 4012060..4012983 | + | 924 | WP_004573727.1 | LysR family transcriptional regulator | - |
M2J85_RS18860 (M2J85_18780) | 4013032..4013862 | + | 831 | WP_003250518.1 | AraC family transcriptional regulator | - |
M2J85_RS18865 (M2J85_18785) | 4013914..4014498 | + | 585 | WP_060537711.1 | LysE family transporter | - |
M2J85_RS18870 (M2J85_18790) | 4014538..4015737 | - | 1200 | WP_003250514.1 | sugar transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15956.26 Da Isoelectric Point: 5.6016
>T244174 WP_060537713.1 NZ_CP096920:c4010714-4010277 [Pseudomonas putida]
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTIMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDGSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
VILWRISAYADLSGTGGLRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTIMRLLRIELPDTVSQAQLPALQ
PGWSAQPELTRTLGNRFLDDGSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
Download Length: 438 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16956.46 Da Isoelectric Point: 5.7258
>AT244174 WP_003250525.1 NZ_CP096920:c4011160-4010711 [Pseudomonas putida]
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEAGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|