Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 343708..344699 | Replicon | chromosome |
Accession | NZ_CP096920 | ||
Organism | Pseudomonas putida strain NY4811 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M2J85_RS01515 | Protein ID | WP_232435437.1 |
Coordinates | 343708..344184 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | Q88R60 |
Locus tag | M2J85_RS01520 | Protein ID | WP_004575922.1 |
Coordinates | 344226..344699 (+) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J85_RS01495 (M2J85_01490) | 338749..340116 | - | 1368 | WP_060539158.1 | ATP-binding protein | - |
M2J85_RS01500 (M2J85_01495) | 340118..340837 | - | 720 | WP_004575925.1 | response regulator | - |
M2J85_RS01505 (M2J85_01500) | 340978..343275 | + | 2298 | WP_003255779.1 | TonB-dependent siderophore receptor | - |
M2J85_RS01510 (M2J85_01505) | 343443..343649 | - | 207 | WP_003255778.1 | DUF3079 domain-containing protein | - |
M2J85_RS01515 (M2J85_01510) | 343708..344184 | + | 477 | WP_232435437.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M2J85_RS01520 (M2J85_01515) | 344226..344699 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
M2J85_RS01525 (M2J85_01520) | 344704..344917 | - | 214 | Protein_294 | integrase | - |
M2J85_RS01530 (M2J85_01525) | 345120..345362 | + | 243 | WP_232435436.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
M2J85_RS01535 (M2J85_01530) | 345321..345479 | - | 159 | Protein_296 | transcriptional regulator | - |
M2J85_RS01540 (M2J85_01535) | 345474..345689 | - | 216 | Protein_297 | integrase | - |
M2J85_RS01545 (M2J85_01540) | 345677..346036 | + | 360 | Protein_298 | phage portal protein | - |
M2J85_RS01550 (M2J85_01545) | 346050..346403 | - | 354 | WP_146051591.1 | hypothetical protein | - |
M2J85_RS01555 (M2J85_01550) | 346652..347194 | - | 543 | WP_004575918.1 | ImmA/IrrE family metallo-endopeptidase | - |
M2J85_RS01560 (M2J85_01555) | 347772..348695 | - | 924 | WP_259537442.1 | IS3 family transposase | - |
M2J85_RS01565 (M2J85_01560) | 348692..348985 | - | 294 | WP_060537279.1 | transposase | - |
M2J85_RS01570 (M2J85_01565) | 349248..349682 | - | 435 | WP_004577124.1 | DUF4145 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18459.43 Da Isoelectric Point: 10.2237
>T244171 WP_232435437.1 NZ_CP096920:343708-344184 [Pseudomonas putida]
MTGINPLAIARSPYIAHPDIWLTDIWIRDIFHPMLVRRDNTMRVITKAAVTKAIEAHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWVTVSGWSVDRIPHSELRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MTGINPLAIARSPYIAHPDIWLTDIWIRDIFHPMLVRRDNTMRVITKAAVTKAIEAHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWVTVSGWSVDRIPHSELRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 477 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT244171 WP_004575922.1 NZ_CP096920:344226-344699 [Pseudomonas putida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|