Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 2375338..2375891 | Replicon | chromosome |
| Accession | NZ_CP096916 | ||
| Organism | Alcaligenes faecalis strain NY11312 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M2J83_RS11155 | Protein ID | WP_086060439.1 |
| Coordinates | 2375338..2375664 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M2J83_RS11160 | Protein ID | WP_270115614.1 |
| Coordinates | 2375661..2375891 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J83_RS11135 (M2J83_11115) | 2371402..2372793 | + | 1392 | WP_222668021.1 | integrating conjugative element protein | - |
| M2J83_RS11140 (M2J83_11120) | 2372790..2373191 | + | 402 | WP_222668020.1 | hypothetical protein | - |
| M2J83_RS11145 (M2J83_11125) | 2373206..2374831 | + | 1626 | WP_222668019.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| M2J83_RS11150 (M2J83_11130) | 2374835..2375086 | - | 252 | WP_222668018.1 | hypothetical protein | - |
| M2J83_RS11155 (M2J83_11135) | 2375338..2375664 | - | 327 | WP_086060439.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2J83_RS11160 (M2J83_11140) | 2375661..2375891 | - | 231 | WP_270115614.1 | antitoxin MazE family protein | Antitoxin |
| M2J83_RS11165 (M2J83_11145) | 2376042..2376413 | - | 372 | WP_222668017.1 | hypothetical protein | - |
| M2J83_RS11170 (M2J83_11150) | 2376595..2378022 | - | 1428 | WP_086060051.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11567.56 Da Isoelectric Point: 10.0902
>T244168 WP_086060439.1 NZ_CP096916:c2375664-2375338 [Alcaligenes faecalis]
MRRGDLVTVAMQGDFGKPRPALVIQADLFAAHSSVTVLPVTSTIVNAPLLRISIQPDLENGLQKPSQIMIDKALTVKRDK
IGQAFGSVSADTLVEIERSLAVFLGIAK
MRRGDLVTVAMQGDFGKPRPALVIQADLFAAHSSVTVLPVTSTIVNAPLLRISIQPDLENGLQKPSQIMIDKALTVKRDK
IGQAFGSVSADTLVEIERSLAVFLGIAK
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|