Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 1694634..1695144 Replicon chromosome
Accession NZ_CP096916
Organism Alcaligenes faecalis strain NY11312

Toxin (Protein)


Gene name relB Uniprot ID U1YHF7
Locus tag M2J83_RS07850 Protein ID WP_009459444.1
Coordinates 1694634..1694897 (-) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A2U2BGR2
Locus tag M2J83_RS07855 Protein ID WP_045931650.1
Coordinates 1694890..1695144 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2J83_RS07820 (M2J83_07805) 1689975..1690550 + 576 WP_270119495.1 lysozyme -
M2J83_RS07825 (M2J83_07810) 1690543..1690791 + 249 WP_270119496.1 hypothetical protein -
M2J83_RS07830 (M2J83_07815) 1690870..1691373 - 504 WP_270119500.1 hypothetical protein -
M2J83_RS07835 (M2J83_07820) 1692075..1692407 - 333 WP_270119502.1 hypothetical protein -
M2J83_RS07840 (M2J83_07825) 1692919..1693101 - 183 WP_270119503.1 DUF2158 domain-containing protein -
M2J83_RS07850 (M2J83_07835) 1694634..1694897 - 264 WP_009459444.1 Txe/YoeB family addiction module toxin Toxin
M2J83_RS07855 (M2J83_07840) 1694890..1695144 - 255 WP_045931650.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
M2J83_RS07860 (M2J83_07845) 1695335..1695604 + 270 WP_270119506.1 hypothetical protein -
M2J83_RS07865 (M2J83_07850) 1695642..1696331 - 690 WP_086061075.1 S24 family peptidase -
M2J83_RS07870 (M2J83_07855) 1696285..1696854 - 570 WP_270119508.1 hypothetical protein -
M2J83_RS07875 (M2J83_07860) 1696871..1697662 + 792 WP_270119509.1 hypothetical protein -
M2J83_RS07880 (M2J83_07865) 1697646..1698353 + 708 WP_270119512.1 replication protein P -
M2J83_RS07885 (M2J83_07870) 1698361..1698684 + 324 WP_270119514.1 DUF1064 domain-containing protein -
M2J83_RS07890 (M2J83_07875) 1698698..1699078 + 381 WP_270119516.1 hypothetical protein -
M2J83_RS07895 (M2J83_07880) 1699075..1699323 + 249 WP_009459904.1 hypothetical protein -
M2J83_RS07900 (M2J83_07885) 1699498..1699917 + 420 WP_270119520.1 phage tail terminator-like protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1648720..1718570 69850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10382.88 Da        Isoelectric Point: 9.0343

>T244167 WP_009459444.1 NZ_CP096916:c1694897-1694634 [Alcaligenes faecalis]
MTDRLLCWTDAAWIDYVYWQGQDRKTLKRINRLIEEVRRAPFDGIGKPEALKENLSGFWSRRIDDTNRLVYAVDKASITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9413.59 Da        Isoelectric Point: 4.7778

>AT244167 WP_045931650.1 NZ_CP096916:c1695144-1694890 [Alcaligenes faecalis]
MKIISFSEARNSLKAVLDGVVDDANTTIITRRDAEDAVVMSLDYYNSLMETVHLLRSPANAEHLSRSIEQYRAGKAMPRE
LSDD

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U1YHF7

Antitoxin

Source ID Structure
AlphaFold DB A0A2U2BGR2

References