Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpB-mazE/PRK09812-ChpS
Location 53768..54363 Replicon plasmid pNY7610-NR
Accession NZ_CP096915
Organism Pseudomonas aeruginosa strain NY7610

Toxin (Protein)


Gene name chpB Uniprot ID A0A2K4Y2Z0
Locus tag M2J79_RS34610 Protein ID WP_023100676.1
Coordinates 53768..54118 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag M2J79_RS34615 Protein ID WP_034017785.1
Coordinates 54115..54363 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2J79_RS34575 (M2J79_34530) 49470..49961 + 492 WP_023100670.1 hypothetical protein -
M2J79_RS34580 (M2J79_34535) 50193..50936 + 744 WP_023100671.1 glyoxalase superfamily protein -
M2J79_RS34585 (M2J79_34540) 51260..51523 + 264 WP_020303033.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
M2J79_RS34590 (M2J79_34545) 51510..51791 + 282 WP_023100672.1 type II toxin-antitoxin system YafQ family toxin -
M2J79_RS34595 (M2J79_34550) 51828..52163 + 336 WP_023100673.1 hypothetical protein -
M2J79_RS34600 (M2J79_34555) 52545..52997 + 453 WP_023100674.1 hypothetical protein -
M2J79_RS34605 (M2J79_34560) 53046..53768 - 723 WP_031634065.1 hypothetical protein -
M2J79_RS34610 (M2J79_34565) 53768..54118 - 351 WP_023100676.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2J79_RS34615 (M2J79_34570) 54115..54363 - 249 WP_034017785.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
M2J79_RS34620 (M2J79_34575) 54360..54779 - 420 WP_057380713.1 hypothetical protein -
M2J79_RS34625 (M2J79_34580) 54853..55329 - 477 WP_034026837.1 single-stranded DNA-binding protein -
M2J79_RS34630 (M2J79_34585) 55380..55778 - 399 WP_176742248.1 hypothetical protein -
M2J79_RS34635 (M2J79_34590) 55787..56470 - 684 WP_034018055.1 hypothetical protein -
M2J79_RS34640 (M2J79_34595) 56467..57003 - 537 WP_034018056.1 hypothetical protein -
M2J79_RS34645 (M2J79_34600) 57000..57230 - 231 WP_034026840.1 hypothetical protein -
M2J79_RS34650 (M2J79_34605) 57220..59289 - 2070 WP_034026842.1 DNA cytosine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..130277 130277


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(11-112)

Antitoxin

Antitoxin PemI-like

(1-81)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12073.06 Da        Isoelectric Point: 10.1005

>T244166 WP_023100676.1 NZ_CP096915:c54118-53768 [Pseudomonas aeruginosa]
MSKRLQHQFDRGDIVSLDMGSASAQAACKALVLSPAAYNVLGLALAIPITEHDSSRYAGFAVAILLPGRTPAKGAALVNL
VRPVDLAARGAKLLGKAPQTTIDEALQRLQAVVGKD

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8753.01 Da        Isoelectric Point: 4.1093

>AT244166 WP_034017785.1 NZ_CP096915:c54363-54115 [Pseudomonas aeruginosa]
MKTTIRAIGNSQGITIPKPLLAELGVSLGDPVDISFKDQTLVVTKVATEYDLSTLVAQCDLEAPEPPDIQCWRTATPVGN
EA

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K4Y2Z0

Antitoxin

Source ID Structure

References