Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 121667..122360 | Replicon | plasmid pNY7610-IMP |
| Accession | NZ_CP096914 | ||
| Organism | Pseudomonas aeruginosa strain NY7610 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | N2IHR9 |
| Locus tag | M2J79_RS34100 | Protein ID | WP_003151133.1 |
| Coordinates | 121667..122044 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | M2J79_RS34105 | Protein ID | WP_001172026.1 |
| Coordinates | 122025..122360 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2J79_RS34080 (M2J79_34030) | 117524..118141 | + | 618 | WP_049277571.1 | recombinase family protein | - |
| M2J79_RS34085 (M2J79_34035) | 118056..118334 | - | 279 | Protein_118 | RimK/LysX family protein | - |
| M2J79_RS34090 (M2J79_34040) | 118482..119726 | - | 1245 | WP_049277576.1 | HD-GYP domain-containing protein | - |
| M2J79_RS34095 (M2J79_34045) | 119801..121123 | - | 1323 | WP_049277574.1 | PAS domain-containing methyl-accepting chemotaxis protein | - |
| M2J79_RS34100 (M2J79_34050) | 121667..122044 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M2J79_RS34105 (M2J79_34055) | 122025..122360 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M2J79_RS34110 (M2J79_34060) | 122375..122710 | + | 336 | WP_000741275.1 | hypothetical protein | - |
| M2J79_RS34115 (M2J79_34065) | 122734..123060 | + | 327 | WP_000091614.1 | hypothetical protein | - |
| M2J79_RS34120 (M2J79_34070) | 123057..123428 | + | 372 | WP_023103794.1 | hypothetical protein | - |
| M2J79_RS34125 (M2J79_34075) | 123786..124040 | - | 255 | WP_121757888.1 | hypothetical protein | - |
| M2J79_RS34130 (M2J79_34080) | 124116..124310 | - | 195 | WP_121757889.1 | hypothetical protein | - |
| M2J79_RS34135 (M2J79_34085) | 124770..125027 | + | 258 | WP_121757891.1 | hypothetical protein | - |
| M2J79_RS34140 (M2J79_34090) | 125039..125278 | + | 240 | WP_121757892.1 | hypothetical protein | - |
| M2J79_RS34145 (M2J79_34095) | 125275..125664 | - | 390 | WP_121757893.1 | hypothetical protein | - |
| M2J79_RS34150 (M2J79_34100) | 125712..126623 | - | 912 | WP_208722306.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaIMP-1 / aac(3)-IId / aph(6)-Id / aph(3'')-Ib | - | 1..152682 | 152682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T244164 WP_003151133.1 NZ_CP096914:121667-122044 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024ELN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A024EKI7 |