Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 1658602..1659175 Replicon chromosome
Accession NZ_CP096913
Organism Pseudomonas aeruginosa strain NY7610

Toxin (Protein)


Gene name relE Uniprot ID W5IUR0
Locus tag M2J79_RS07815 Protein ID WP_009618209.1
Coordinates 1658888..1659175 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID W5ISI7
Locus tag M2J79_RS07810 Protein ID WP_009618210.1
Coordinates 1658602..1658901 (+) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2J79_RS07780 (M2J79_07770) 1653706..1653924 + 219 WP_016446183.1 AlpA family transcriptional regulator -
M2J79_RS07785 (M2J79_07775) 1653965..1654831 + 867 WP_194498159.1 ParA family protein -
M2J79_RS07790 (M2J79_07780) 1654815..1655051 + 237 WP_013982111.1 type II toxin-antitoxin system HicA family toxin -
M2J79_RS07795 (M2J79_07785) 1655044..1656702 + 1659 WP_194498158.1 ParB family protein -
M2J79_RS07800 (M2J79_07790) 1656720..1657280 + 561 WP_016446180.1 DUF2857 domain-containing protein -
M2J79_RS07805 (M2J79_07795) 1657284..1658477 + 1194 WP_194498157.1 STY4528 family pathogenicity island replication protein -
M2J79_RS07810 (M2J79_07800) 1658602..1658901 + 300 WP_009618210.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
M2J79_RS07815 (M2J79_07805) 1658888..1659175 + 288 WP_009618209.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M2J79_RS07820 (M2J79_07810) 1659204..1659395 + 192 WP_009618207.1 hypothetical protein -
M2J79_RS07825 (M2J79_07815) 1659519..1660298 + 780 WP_141984816.1 TIGR03761 family integrating conjugative element protein -
M2J79_RS07830 (M2J79_07820) 1660295..1660843 + 549 WP_194498156.1 DUF3158 family protein -
M2J79_RS07835 (M2J79_07825) 1660840..1661223 + 384 WP_023083180.1 single-stranded DNA-binding protein -
M2J79_RS07840 (M2J79_07830) 1661515..1663530 + 2016 WP_018076215.1 DNA topoisomerase III -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1630459..1716472 86013


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-58)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10854.46 Da        Isoelectric Point: 8.4628

>T244159 WP_009618209.1 NZ_CP096913:1658888-1659175 [Pseudomonas aeruginosa]
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE

Download         Length: 288 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10816.46 Da        Isoelectric Point: 8.6579

>AT244159 WP_009618210.1 NZ_CP096913:1658602-1658901 [Pseudomonas aeruginosa]
MAAQTSMLHIRVDDKLKADAAEKLAGVGLTVSDAVRILLTRVVKEGALPAGLTADPEAYDAWFRAKVQEALADTRPPVPH
QQVMDEAQALIDRKRRART

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5R9QF16

Antitoxin

Source ID Structure
AlphaFold DB A0A5R9QE11

References