Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 28114..28807 | Replicon | plasmid pNY8688-NR |
Accession | NZ_CP096911 | ||
Organism | Pseudomonas aeruginosa strain NY8688 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | M2J77_RS32670 | Protein ID | WP_003151133.1 |
Coordinates | 28430..28807 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | M2J77_RS32665 | Protein ID | WP_001172026.1 |
Coordinates | 28114..28449 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J77_RS32615 (M2J77_32540) | 23426..23680 | - | 255 | WP_196994195.1 | hypothetical protein | - |
M2J77_RS32620 (M2J77_32545) | 23707..23913 | - | 207 | WP_152996423.1 | hypothetical protein | - |
M2J77_RS32625 (M2J77_32550) | 24026..24325 | - | 300 | WP_196994194.1 | hypothetical protein | - |
M2J77_RS32630 (M2J77_32555) | 24354..24545 | - | 192 | WP_196994193.1 | hypothetical protein | - |
M2J77_RS32635 (M2J77_32560) | 24621..24887 | - | 267 | WP_196994192.1 | hypothetical protein | - |
M2J77_RS32640 (M2J77_32565) | 24926..25996 | - | 1071 | WP_196994191.1 | DNA-binding protein | - |
M2J77_RS32645 (M2J77_32570) | 26268..27017 | - | 750 | Protein_45 | DUF3560 domain-containing protein | - |
M2J77_RS32650 (M2J77_32575) | 27057..27398 | - | 342 | WP_025999701.1 | hypothetical protein | - |
M2J77_RS32655 (M2J77_32580) | 27414..27740 | - | 327 | WP_000091614.1 | hypothetical protein | - |
M2J77_RS32660 (M2J77_32585) | 27764..28099 | - | 336 | WP_000741275.1 | hypothetical protein | - |
M2J77_RS32665 (M2J77_32590) | 28114..28449 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M2J77_RS32670 (M2J77_32595) | 28430..28807 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J77_RS32675 (M2J77_32600) | 28999..29601 | + | 603 | WP_010465829.1 | recombinase family protein | - |
M2J77_RS32680 (M2J77_32605) | 29585..32614 | + | 3030 | WP_270145813.1 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..58793 | 58793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T244151 WP_003151133.1 NZ_CP096911:c28807-28430 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |