Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4170080..4171122 | Replicon | chromosome |
Accession | NZ_CP096909 | ||
Organism | Pseudomonas aeruginosa strain NY8688 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | M2J77_RS19445 | Protein ID | WP_003109777.1 |
Coordinates | 4170080..4170655 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | M2J77_RS19450 | Protein ID | WP_003050245.1 |
Coordinates | 4170652..4171122 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J77_RS19420 (M2J77_19375) | 4166518..4167243 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
M2J77_RS19425 (M2J77_19380) | 4167282..4168184 | - | 903 | WP_003105624.1 | CBASS oligonucleotide cyclase | - |
M2J77_RS19430 (M2J77_19385) | 4168184..4168684 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
M2J77_RS19435 (M2J77_19390) | 4168681..4169151 | - | 471 | WP_003105626.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
M2J77_RS19440 (M2J77_19395) | 4169148..4170062 | - | 915 | WP_003105629.1 | AAA family ATPase | - |
M2J77_RS19445 (M2J77_19400) | 4170080..4170655 | - | 576 | WP_003109777.1 | PIN domain-containing protein | Toxin |
M2J77_RS19450 (M2J77_19405) | 4170652..4171122 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
M2J77_RS19455 (M2J77_19410) | 4171326..4171709 | + | 384 | WP_003120001.1 | RAQPRD family integrative conjugative element protein | - |
M2J77_RS19460 (M2J77_19415) | 4171706..4171939 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
M2J77_RS19465 (M2J77_19420) | 4171956..4172315 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
M2J77_RS19470 (M2J77_19425) | 4172327..4172725 | + | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
M2J77_RS19475 (M2J77_19430) | 4172722..4173414 | + | 693 | WP_003105641.1 | TIGR03746 family integrating conjugative element protein | - |
M2J77_RS19480 (M2J77_19435) | 4173411..4174322 | + | 912 | WP_003105643.1 | TIGR03749 family integrating conjugative element protein | - |
M2J77_RS19485 (M2J77_19440) | 4174312..4175730 | + | 1419 | WP_020924934.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4120549..4221515 | 100966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21644.79 Da Isoelectric Point: 5.6172
>T244147 WP_003109777.1 NZ_CP096909:c4170655-4170080 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIEVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT244147 WP_003050245.1 NZ_CP096909:c4171122-4170652 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|