Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1840398..1841006 | Replicon | chromosome |
Accession | NZ_CP096909 | ||
Organism | Pseudomonas aeruginosa strain NY8688 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A3S4N9Q9 |
Locus tag | M2J77_RS08535 | Protein ID | WP_031672658.1 |
Coordinates | 1840659..1841006 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | M2J77_RS08530 | Protein ID | WP_003114155.1 |
Coordinates | 1840398..1840649 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2J77_RS08510 (M2J77_08505) | 1836036..1836386 | + | 351 | WP_003159569.1 | DUF2523 family protein | - |
M2J77_RS08515 (M2J77_08510) | 1836388..1837650 | + | 1263 | WP_049290957.1 | zonular occludens toxin domain-containing protein | - |
M2J77_RS08520 (M2J77_08515) | 1837909..1839201 | + | 1293 | WP_071659043.1 | hypothetical protein | - |
M2J77_RS08525 (M2J77_08520) | 1839201..1840184 | + | 984 | WP_031672657.1 | tyrosine-type recombinase/integrase | - |
M2J77_RS08530 (M2J77_08525) | 1840398..1840649 | + | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M2J77_RS08535 (M2J77_08530) | 1840659..1841006 | + | 348 | WP_031672658.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2J77_RS08545 (M2J77_08540) | 1841333..1842235 | - | 903 | WP_003123042.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
M2J77_RS08550 (M2J77_08545) | 1842686..1843423 | - | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
M2J77_RS08555 (M2J77_08550) | 1843503..1844546 | - | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
M2J77_RS08560 (M2J77_08555) | 1844682..1845374 | - | 693 | WP_003098362.1 | 16S rRNA pseudouridine(516) synthase | - |
M2J77_RS08565 (M2J77_08560) | 1845374..1845646 | - | 273 | WP_003120794.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1827848..1841156 | 13308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12898.69 Da Isoelectric Point: 4.5143
>T244144 WP_031672658.1 NZ_CP096909:1840659-1841006 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGAQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGAQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S4N9Q9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |